CB304403

Overview
NameCB304403
Unique NameCB304403
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length643
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CB304403_ssr461 microsatellite CB304403_ssr461:461..470. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7663 contig Csv1_Contig7663:38..680. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304403 vs. ExPASy Swiss-Prot
Match: RLA31_ARATH (60S acidic ribosomal protein P3-1 OS=Arabidopsis thaliana GN=RPP3A PE=1 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 6.287e-23
Identity = 55/68 (80.88%), Postives = 61/68 (89.71%), Query Frame = -1
Query:  392 MGVFTYVCRKNGGEWSGKQIEGGDLEASAASTYELQRKLVQTSLSADSSGGVQSSFSLVTPTSAVFQV 595
            MGVFT+VC+  GG WS KQ EG +LE+SA+STYELQRKLVQ SLSADSSGGVQSSFSLV+PTSAVFQV
Sbjct:    1 MGVFTFVCKNGGGAWSAKQHEG-ELESSASSTYELQRKLVQVSLSADSSGGVQSSFSLVSPTSAVFQV 67          
BLAST of CB304403 vs. ExPASy Swiss-Prot
Match: RLA32_ARATH (60S acidic ribosomal protein P3-2 OS=Arabidopsis thaliana GN=RPP3B PE=1 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.072e-22
Identity = 54/68 (79.41%), Postives = 62/68 (91.18%), Query Frame = -1
Query:  392 MGVFTYVCRKNGGEWSGKQIEGGDLEASAASTYELQRKLVQTSLSADSSGGVQSSFSLVTPTSAVFQV 595
            MGVF++VC+  GGEW+ KQ EG DLEASA+STY+LQRKLVQT+LSADSSGGVQSSFSLV+PTSAVF V
Sbjct:    1 MGVFSFVCKSKGGEWTAKQHEG-DLEASASSTYDLQRKLVQTALSADSSGGVQSSFSLVSPTSAVFVV 67          
BLAST of CB304403 vs. ExPASy Swiss-Prot
Match: RLA3_MAIZE (60S acidic ribosomal protein P3 OS=Zea mays GN=RPP3A PE=1 SV=3)

HSP 1 Score: 98.9821 bits (245), Expect = 2.236e-20
Identity = 57/121 (47.11%), Postives = 69/121 (57.02%), Query Frame = -1
Query:  233 MGVFTYVCRKNGGEWSGKQIEGGDLEASAASTYELQRKLVQTSLSADSSGGVQSSFSLVTPTSAVFQVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXESDEDMGFSLFD 595
            MGV+T+VCR NGGEW+ KQ   G++EASAA+ YELQR+LV  + +ADS  GVQSSFS+VTP+SAVFQV                                         ESD+DMGFSLFD
Sbjct:    1 MGVYTFVCRNNGGEWTAKQ-HSGEIEASAATPYELQRRLVAAASAADSRYGVQSSFSMVTPSSAVFQVIVGAVGGGAMMVSGGGGGGAAASGGAAAEAPKEEKKEEEKEESDDDMGFSLFD 120          
BLAST of CB304403 vs. ExPASy Swiss-Prot
Match: RLA3_ORYSJ (60S acidic ribosomal protein P3 OS=Oryza sativa subsp. japonica GN=Os06g0701400 PE=3 SV=3)

HSP 1 Score: 91.6633 bits (226), Expect = 3.570e-18
Identity = 44/68 (64.71%), Postives = 59/68 (86.76%), Query Frame = -1
Query:  392 MGVFTYVCRKNGGEWSGKQIEGGDLEASAASTYELQRKLVQTSLSADSSGGVQSSFSLVTPTSAVFQV 595
            MGV+T+VCR +G EW+ KQ++G +LEASAA+ YELQR+LV  + +ADS+ GVQSSFS+V+P+SAVFQV
Sbjct:    1 MGVYTFVCRSSGDEWTAKQLKG-ELEASAATPYELQRRLVAAASAADSAAGVQSSFSMVSPSSAVFQV 67          
The following BLAST results are available for this feature:
BLAST of CB304403 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
RLA31_ARATH6.287e-2380.8860S acidic ribosomal protein P3-1 OS=Arabidopsis t... [more]
RLA32_ARATH1.072e-2279.4160S acidic ribosomal protein P3-2 OS=Arabidopsis t... [more]
RLA3_MAIZE2.236e-2047.1160S acidic ribosomal protein P3 OS=Zea mays GN=RPP... [more]
RLA3_ORYSJ3.570e-1864.7160S acidic ribosomal protein P3 OS=Oryza sativa su... [more]
back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0001_IIIaR_C12 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0001_IIIaR_C12 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304403 ID=CB304403|Name=CB304403|organism=Citrus sinensis|type=EST|length=643bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTGGAATGAAAAAGGTCTGGTA
ATAGACATGGAGCAGCAAGCTAATCATGTTTACTTAATATTGATGGGGGA
CAAAAATCCCTCACAAAGTAACAAAACTCTCACAAAAATAAAATCTAAGC
CAATGGCAGAGCAATTTTTGAGTCGACATAAAAGCATAACAAAATACAAG
TCCCAAGAAGAGAACTGGAATTATATAACCTAATCAAAAAGAGAGAAACC
CATGTCTTCATCACTCTCCTCTTTCTCTTCCTTCTTCTCCTCAGCAGCAG
GAGCCTCAGCAGCTGCTCCACCGCCTCCTGAAGGGGCTGAAGCTGCAGCT
CCACCTCCAATGAAACCACTACCAACAGCACCACCAATAATCACCTGGAA
AACAGCAGACGTAGGTGTGACGAGGGAGAAAGAGGACTGGACCCCACCAG
AAGAATCAGCAGAGAGAGAGGTCTGGACCAGCTTTCTCTGGAGCTCGTAT
GTTGATGCTGCAGAGGCTTCTAAGTCTCCCCCCTCTATCTGCTTTCCGCT
CCATTCTCCCCCATTTTTTCTGCACACGTATGTGAAAACTCCCATTTTCA
CTTGATATTCTTTTTGTCTTTGGGCGGCACAATGTACTAAATA
back to top