CB304456

Overview
NameCB304456
Unique NameCB304456
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length486
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig13819 contig Csv1_Contig13819:23..508. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304456 vs. ExPASy Swiss-Prot
Match: PSMD3_TOBAC (Probable 26S proteasome non-ATPase regulatory subunit 3 OS=Nicotiana tabacum GN=21D7 PE=2 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 1.596e-17
Identity = 44/63 (69.84%), Postives = 46/63 (73.02%), Query Frame = -3
Query:  296 NEPQLAFNSRIAFCLNMHNEAVRALRFPPNSHXXXXXXXXXXXXXXXXXELAKHIAEEDDDEF 484
            NEPQ+AFNSRIAFCLNMHNEAVRALRFPPNSH                 ELAKHIAEEDDD+F
Sbjct:  426 NEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDDF 488          
BLAST of CB304456 vs. ExPASy Swiss-Prot
Match: PSMD3_DAUCA (Probable 26S proteasome non-ATPase regulatory subunit 3 OS=Daucus carota GN=21D7 PE=1 SV=2)

HSP 1 Score: 85.5001 bits (210), Expect = 1.351e-16
Identity = 44/63 (69.84%), Postives = 44/63 (69.84%), Query Frame = -3
Query:  296 NEPQLAFNSRIAFCLNMHNEAVRALRFPPNSHXXXXXXXXXXXXXXXXXELAKHIAEEDDDEF 484
            NEPQ AFNSRIAFCLNMHNEAVRALRFP NSH                 ELAKHIAEEDDDEF
Sbjct:  427 NEPQAAFNSRIAFCLNMHNEAVRALRFPANSHKDKESAEKRRERQQQEQELAKHIAEEDDDEF 489          
BLAST of CB304456 vs. ExPASy Swiss-Prot
Match: PSD31_ARATH (Probable 26S proteasome non-ATPase regulatory subunit 3a OS=Arabidopsis thaliana GN=EMB2719 PE=1 SV=3)

HSP 1 Score: 85.1149 bits (209), Expect = 1.765e-16
Identity = 42/63 (66.67%), Postives = 45/63 (71.43%), Query Frame = -3
Query:  296 NEPQLAFNSRIAFCLNMHNEAVRALRFPPNSHXXXXXXXXXXXXXXXXXELAKHIAEEDDDEF 484
            NEPQ AFNSRIAFCLNMHNEAVRALRFPPN+H                 ELAKH+AEEDDD+F
Sbjct:  426 NEPQTAFNSRIAFCLNMHNEAVRALRFPPNTHKEKESDEKRRERKQQEEELAKHMAEEDDDDF 488          
BLAST of CB304456 vs. ExPASy Swiss-Prot
Match: PSD32_ARATH (Probable 26S proteasome non-ATPase regulatory subunit 3b OS=Arabidopsis thaliana GN=At1g75990 PE=2 SV=2)

HSP 1 Score: 82.8037 bits (203), Expect = 8.760e-16
Identity = 41/63 (65.08%), Postives = 45/63 (71.43%), Query Frame = -3
Query:  296 NEPQLAFNSRIAFCLNMHNEAVRALRFPPNSHXXXXXXXXXXXXXXXXXELAKHIAEEDDDEF 484
            NEPQ AFNSRIAFCLNMHNEAVRALRFPPN+H                 ELAK++AEEDDD+F
Sbjct:  425 NEPQTAFNSRIAFCLNMHNEAVRALRFPPNTHREKESEEKRREMKQQEEELAKYMAEEDDDDF 487          
The following BLAST results are available for this feature:
BLAST of CB304456 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
PSMD3_TOBAC1.596e-1769.84Probable 26S proteasome non-ATPase regulatory subu... [more]
PSMD3_DAUCA1.351e-1669.84Probable 26S proteasome non-ATPase regulatory subu... [more]
PSD31_ARATH1.765e-1666.67Probable 26S proteasome non-ATPase regulatory subu... [more]
PSD32_ARATH8.760e-1665.08Probable 26S proteasome non-ATPase regulatory subu... [more]
back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0001_IIaR_B02 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0001_IIaR_B02 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304456 ID=CB304456|Name=CB304456|organism=Citrus sinensis|type=EST|length=486bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTGGATCAAATGGCTATGGTCT
GCAATTGACAAAAACAAGATTAAGACGAGCAACCCGGGGGTTACTTCAAA
ACAATAATGCAGCGGTTCCTCAAGTTTAACAAAGAAAGCCTAAGACATGA
ACTAAGAGCAAGACCTATCAAATATAATGGTCAACCAGAAGACGAAAATC
AGAATGCTTTAACAGAAGTATTTCAGAGGAAGGTGCGGAACTAGATGAAA
GCATTCTGTAGGGAAAAAAAGATGTGCTTGCAGATAACTAATTTAAAACT
CATCGTCATCCTCCTCAGCAATGTGTTTTGCAAGCTCTTGTTCCTGCTGC
TGTCTCTCCCTCCTCTTCTCGGCACTTTCCTTTTCCTTGTGGGAATTTGG
GGGAAAACGAAGTGCACGAACTGCCTCGTTATGCATATTGAGGCAGAAAG
CAATCCTTGAATTGAATGCAAGCTGAGGTTCGTTTG
back to top