CB305100

Overview
NameCB305100
Unique NameCB305100
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length395
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1498 contig Csv1_Contig1498:444..830. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB305100 vs. ExPASy Swiss-Prot
Match: NDK1_ARATH (Nucleoside diphosphate kinase 1 OS=Arabidopsis thaliana GN=NDPK1 PE=1 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 1.146e-11
Identity = 28/34 (82.35%), Postives = 32/34 (94.12%), Query Frame = -2
Query:  263 HGSDSVESAQKEIALWFPDGLINWQSSLPPWIYE 364
            HGSDSVESA+KEIALWFPDG +NWQSS+ PW+YE
Sbjct:  115 HGSDSVESARKEIALWFPDGPVNWQSSVHPWVYE 148          
BLAST of CB305100 vs. ExPASy Swiss-Prot
Match: NDKB_FLABI (Nucleoside diphosphate kinase B OS=Flaveria bidentis PE=2 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 9.703e-11
Identity = 27/34 (79.41%), Postives = 31/34 (91.18%), Query Frame = -2
Query:  263 HGSDSVESAQKEIALWFPDGLINWQSSLPPWIYE 364
            HGSD+VESA+KEIALWFP+G+ NW SSL PWIYE
Sbjct:  115 HGSDAVESAKKEIALWFPEGVANWSSSLHPWIYE 148          
The following BLAST results are available for this feature:
BLAST of CB305100 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
NDK1_ARATH1.146e-1182.35Nucleoside diphosphate kinase 1 OS=Arabidopsis tha... [more]
NDKB_FLABI9.703e-1179.41Nucleoside diphosphate kinase B OS=Flaveria bident... [more]
back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0003_IaR_B04 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0003_IaR_B04 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB305100 ID=CB305100|Name=CB305100|organism=Citrus sinensis|type=EST|length=395bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTGCTAACCATTAACAAACTCA
ATTCATAATACAGTCAACAAAAAAGCTTAAATATTGTATATGGCAACCAC
AAGAATGAAAGCAGCCAACATAACCAGGATTGGTCTCAATTTAACTCAAT
ACTTCATAACAGTTCACCAACAAGGAGTAACCATAAATAAGGAAATAGGG
ATAGGGATAGGGATAAGTCCAACTGCAGGAACAATTAAGCTCCTCAACCA
AACATTAATTTACTCATAGATCCAAGGGGGAAGGCTGCTCTGCCAGTTAA
TAAGGCCATCAGGGAACCACAAGGCGATTTCTTTCTGGGCACTCTCAACT
GAGTCACTTCCATGGGATGATATTCCTGCCCCTCACGATAACCCA
back to top