CB610651
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CB610651 vs. ExPASy Swiss-Prot
Match: IPYR_SOLTU (Soluble inorganic pyrophosphatase OS=Solanum tuberosum GN=PPA PE=2 SV=1) HSP 1 Score: 94.3597 bits (233), Expect = 1.974e-19 Identity = 42/44 (95.45%), Postives = 43/44 (97.73%), Query Frame = 1 Query: 4 IDQGEKDDKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDY 135 IDQGEKDDKIIAVCADDPEYRHY DIK+LPPHRLAEIRRFFEDY Sbjct: 128 IDQGEKDDKIIAVCADDPEYRHYTDIKQLPPHRLAEIRRFFEDY 171
BLAST of CB610651 vs. ExPASy Swiss-Prot
Match: IPYR2_ARATH (Soluble inorganic pyrophosphatase 2 OS=Arabidopsis thaliana GN=PPA2 PE=2 SV=2) HSP 1 Score: 93.9745 bits (232), Expect = 2.579e-19 Identity = 42/44 (95.45%), Postives = 43/44 (97.73%), Query Frame = 1 Query: 4 IDQGEKDDKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDY 135 IDQGEKDDKIIAVCADDPE+RHY DIKELPPHRLAEIRRFFEDY Sbjct: 135 IDQGEKDDKIIAVCADDPEFRHYRDIKELPPHRLAEIRRFFEDY 178
BLAST of CB610651 vs. ExPASy Swiss-Prot
Match: IPYR_ORYSJ (Soluble inorganic pyrophosphatase OS=Oryza sativa subsp. japonica GN=IPP PE=2 SV=1) HSP 1 Score: 91.2781 bits (225), Expect = 1.671e-18 Identity = 40/44 (90.91%), Postives = 42/44 (95.45%), Query Frame = 1 Query: 4 IDQGEKDDKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDY 135 IDQGEKDDKIIAVCADDPEYRH+ DIKE+PPHRL EIRRFFEDY Sbjct: 131 IDQGEKDDKIIAVCADDPEYRHFRDIKEIPPHRLQEIRRFFEDY 174
BLAST of CB610651 vs. ExPASy Swiss-Prot
Match: IPYR_ORYSI (Soluble inorganic pyrophosphatase OS=Oryza sativa subsp. indica GN=IPP PE=2 SV=1) HSP 1 Score: 91.2781 bits (225), Expect = 1.671e-18 Identity = 40/44 (90.91%), Postives = 42/44 (95.45%), Query Frame = 1 Query: 4 IDQGEKDDKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDY 135 IDQGEKDDKIIAVCADDPEYRH+ DIKE+PPHRL EIRRFFEDY Sbjct: 131 IDQGEKDDKIIAVCADDPEYRHFRDIKEIPPHRLQEIRRFFEDY 174
BLAST of CB610651 vs. ExPASy Swiss-Prot
Match: IPYR_MAIZE (Soluble inorganic pyrophosphatase OS=Zea mays GN=IPP PE=2 SV=1) HSP 1 Score: 89.7373 bits (221), Expect = 4.863e-18 Identity = 40/44 (90.91%), Postives = 41/44 (93.18%), Query Frame = 1 Query: 4 IDQGEKDDKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDY 135 IDQGEKDDKIIAVCADDPEYRHYNDI EL PHRL EI+RFFEDY Sbjct: 131 IDQGEKDDKIIAVCADDPEYRHYNDISELSPHRLQEIKRFFEDY 174
BLAST of CB610651 vs. ExPASy Swiss-Prot
Match: IPYR2_CHLRE (Soluble inorganic pyrophosphatase 2 OS=Chlamydomonas reinhardtii GN=ppa2 PE=1 SV=1) HSP 1 Score: 77.411 bits (189), Expect = 2.497e-14 Identity = 33/44 (75.00%), Postives = 40/44 (90.91%), Query Frame = 1 Query: 4 IDQGEKDDKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDY 135 +DQGE+DDK+IAV ADDPEY+ + DI +LPPHRLAEI+RFFEDY Sbjct: 105 LDQGERDDKLIAVHADDPEYKGFTDISQLPPHRLAEIKRFFEDY 148 The following BLAST results are available for this feature:
BLAST of CB610651 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 6
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CB610651 ID=CB610651; Name=CB610651; organism=Citrus sinensis; type=EST; length=164bpback to top |