CB610911
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CB610911 vs. ExPASy Swiss-Prot
Match: AL7B4_ARATH (Aldehyde dehydrogenase family 7 member B4 OS=Arabidopsis thaliana GN=ALDH7B4 PE=2 SV=3) HSP 1 Score: 56.6102 bits (135), Expect = 2.379e-13 Identity = 29/47 (61.70%), Postives = 29/47 (61.70%), Query Frame = 1 Query: 4 GSDTGIVNVNIPTNGAEIXXXXXXXXXXXXXXXXXSDSWKQYMRRST 144 GSD GIVNVNIPTNGAEI SDSWKQYMRRST Sbjct: 444 GSDCGIVNVNIPTNGAEIGGAFGGEKATGGGREAGSDSWKQYMRRST 490 HSP 2 Score: 37.7354 bits (86), Expect = 2.379e-13 Identity = 16/17 (94.12%), Postives = 17/17 (100.00%), Query Frame = 2 Query: 266 TIDYGNELPLAQGINFG 316 TI+YGNELPLAQGINFG Sbjct: 492 TINYGNELPLAQGINFG 508
BLAST of CB610911 vs. ExPASy Swiss-Prot
Match: AL7A1_PEA (Aldehyde dehydrogenase family 7 member A1 OS=Pisum sativum PE=1 SV=3) HSP 1 Score: 56.6102 bits (135), Expect = 8.792e-13 Identity = 29/47 (61.70%), Postives = 29/47 (61.70%), Query Frame = 1 Query: 4 GSDTGIVNVNIPTNGAEIXXXXXXXXXXXXXXXXXSDSWKQYMRRST 144 GSD GIVNVNIPTNGAEI SDSWKQYMRRST Sbjct: 444 GSDCGIVNVNIPTNGAEIGGAFGGEKATGGGREAGSDSWKQYMRRST 490 HSP 2 Score: 35.8094 bits (81), Expect = 8.792e-13 Identity = 15/17 (88.24%), Postives = 17/17 (100.00%), Query Frame = 2 Query: 266 TIDYGNELPLAQGINFG 316 TI+YG+ELPLAQGINFG Sbjct: 492 TINYGSELPLAQGINFG 508
BLAST of CB610911 vs. ExPASy Swiss-Prot
Match: AL7A1_MALDO (Aldehyde dehydrogenase family 7 member A1 OS=Malus domestica PE=1 SV=3) HSP 1 Score: 56.6102 bits (135), Expect = 1.142e-12 Identity = 29/47 (61.70%), Postives = 29/47 (61.70%), Query Frame = 1 Query: 4 GSDTGIVNVNIPTNGAEIXXXXXXXXXXXXXXXXXSDSWKQYMRRST 144 GSD GIVNVNIPTNGAEI SDSWKQYMRRST Sbjct: 444 GSDCGIVNVNIPTNGAEIGGAFGGEKATGGGREAGSDSWKQYMRRST 490 HSP 2 Score: 35.4242 bits (80), Expect = 1.142e-12 Identity = 15/17 (88.24%), Postives = 16/17 (94.12%), Query Frame = 2 Query: 266 TIDYGNELPLAQGINFG 316 TI+YG ELPLAQGINFG Sbjct: 492 TINYGTELPLAQGINFG 508 The following BLAST results are available for this feature:
BLAST of CB610911 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CB610911 ID=CB610911; Name=CB610911; organism=Citrus sinensis; type=EST; length=394bpback to top |