CB611122
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CB611122 vs. ExPASy Swiss-Prot
Match: TRXH2_TOBAC (Thioredoxin H-type 2 OS=Nicotiana tabacum PE=3 SV=1) HSP 1 Score: 88.5817 bits (218), Expect = 1.087e-17 Identity = 42/49 (85.71%), Postives = 46/49 (93.88%), Query Frame = 1 Query: 4 ELKSAVTDWAVEAMPTFMFLKEGKIVDKVVGAKKEELQQTIAKHLATAS 150 ELKS TDWAVEAMPTFMFLKEGKIVDKVVGAKK+ELQQTIAKH+++ S Sbjct: 68 ELKSVATDWAVEAMPTFMFLKEGKIVDKVVGAKKDELQQTIAKHISSTS 116
BLAST of CB611122 vs. ExPASy Swiss-Prot
Match: TRXH_RICCO (Thioredoxin H-type OS=Ricinus communis PE=3 SV=1) HSP 1 Score: 85.1149 bits (209), Expect = 1.202e-16 Identity = 40/49 (81.63%), Postives = 46/49 (93.88%), Query Frame = 1 Query: 4 ELKSAVTDWAVEAMPTFMFLKEGKIVDKVVGAKKEELQQTIAKHLATAS 150 ELK+ +WAVE+MPTFMFLKEGKI+DKVVGAKK+ELQQTIAKH+ATAS Sbjct: 69 ELKTVAHEWAVESMPTFMFLKEGKIMDKVVGAKKDELQQTIAKHMATAS 117
BLAST of CB611122 vs. ExPASy Swiss-Prot
Match: TRXH1_ARATH (Thioredoxin H-type 1 OS=Arabidopsis thaliana GN=TRX1 PE=1 SV=1) HSP 1 Score: 82.4185 bits (202), Expect = 7.791e-16 Identity = 38/46 (82.61%), Postives = 43/46 (93.48%), Query Frame = 1 Query: 4 ELKSAVTDWAVEAMPTFMFLKEGKIVDKVVGAKKEELQQTIAKHLA 141 ELKS +DWA++AMPTFMFLKEGKI+DKVVGAKK+ELQ TIAKHLA Sbjct: 69 ELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKDELQSTIAKHLA 114
BLAST of CB611122 vs. ExPASy Swiss-Prot
Match: TRXH1_TOBAC (Thioredoxin H-type 1 OS=Nicotiana tabacum PE=2 SV=1) HSP 1 Score: 73.9442 bits (180), Expect = 2.771e-13 Identity = 34/49 (69.39%), Postives = 42/49 (85.71%), Query Frame = 1 Query: 4 ELKSAVTDWAVEAMPTFMFLKEGKIVDKVVGAKKEELQQTIAKHLATAS 150 ELK+ +W+VEAMPTF+F+K+GK VD+VVGAKKEELQQTI KH A A+ Sbjct: 75 ELKTVSAEWSVEAMPTFVFIKDGKEVDRVVGAKKEELQQTIVKHAAPAT 123 The following BLAST results are available for this feature:
BLAST of CB611122 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 4
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CB611122 ID=CB611122; Name=CB611122; organism=Citrus sinensis; type=EST; length=381bpback to top |