CF503831
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CF503831 vs. ExPASy Swiss-Prot
Match: PLDB1_ARATH (Phospholipase D beta 1 OS=Arabidopsis thaliana GN=PLDBETA1 PE=2 SV=3) HSP 1 Score: 97.4413 bits (241), Expect = 2.699e-24 Identity = 47/63 (74.60%), Postives = 54/63 (85.71%), Query Frame = 1 Query: 1 GIKKLKSG-DDALLRIERIPGIIGISDAPSVRENDAESWHVQIFRSIDSTSVRGFPKDPKEAT 186 GIKK K DDALLRI+RIP I+G+SD P+V END E+WHVQIFRSIDS SV+GFPKDPK+AT Sbjct: 581 GIKKFKLPIDDALLRIDRIPDILGVSDTPTVSENDPEAWHVQIFRSIDSNSVKGFPKDPKDAT 643 HSP 2 Score: 33.8834 bits (76), Expect = 2.699e-24 Identity = 15/15 (100.00%), Postives = 15/15 (100.00%), Query Frame = 2 Query: 191 KNLVCGKNVLIDMSI 235 KNLVCGKNVLIDMSI Sbjct: 645 KNLVCGKNVLIDMSI 659
BLAST of CF503831 vs. ExPASy Swiss-Prot
Match: PLDG1_ARATH (Phospholipase D gamma 1 OS=Arabidopsis thaliana GN=PLDGAMMA1 PE=1 SV=1) HSP 1 Score: 96.2857 bits (238), Expect = 2.892e-23 Identity = 46/63 (73.02%), Postives = 55/63 (87.30%), Query Frame = 1 Query: 1 GIKKLKSG-DDALLRIERIPGIIGISDAPSVRENDAESWHVQIFRSIDSTSVRGFPKDPKEAT 186 GI KLKS DD+LLRI+RIP I+G+S+A S +ND ESWHVQ+FRSIDS+SV+GFPKDPKEAT Sbjct: 467 GIGKLKSSSDDSLLRIDRIPDIVGLSEASSANDNDPESWHVQVFRSIDSSSVKGFPKDPKEAT 529 HSP 2 Score: 31.5722 bits (70), Expect = 2.892e-23 Identity = 12/20 (60.00%), Postives = 17/20 (85.00%), Query Frame = 2 Query: 176 RKLRSKNLVCGKNVLIDMSI 235 ++ +NL+CGKN+LIDMSI Sbjct: 526 KEATGRNLLCGKNILIDMSI 545
BLAST of CF503831 vs. ExPASy Swiss-Prot
Match: PLDG3_ARATH (Phospholipase D gamma 3 OS=Arabidopsis thaliana GN=PLDGAMMA3 PE=2 SV=1) HSP 1 Score: 92.4337 bits (228), Expect = 4.018e-22 Identity = 43/63 (68.25%), Postives = 55/63 (87.30%), Query Frame = 1 Query: 1 GIKKLK-SGDDALLRIERIPGIIGISDAPSVRENDAESWHVQIFRSIDSTSVRGFPKDPKEAT 186 GI +L+ S DD+LLR++RIP I+G+S+A S +ND ESWHVQ+FRSIDS+SV+GFPKDPKEAT Sbjct: 474 GIGRLRTSSDDSLLRLDRIPDIMGLSEASSANDNDPESWHVQVFRSIDSSSVKGFPKDPKEAT 536 HSP 2 Score: 31.5722 bits (70), Expect = 4.018e-22 Identity = 12/20 (60.00%), Postives = 17/20 (85.00%), Query Frame = 2 Query: 176 RKLRSKNLVCGKNVLIDMSI 235 ++ +NL+CGKN+LIDMSI Sbjct: 533 KEATGRNLLCGKNILIDMSI 552
BLAST of CF503831 vs. ExPASy Swiss-Prot
Match: PLDG2_ARATH (Phospholipase D gamma 2 OS=Arabidopsis thaliana GN=PLDGAMMA2 PE=1 SV=3) HSP 1 Score: 89.7373 bits (221), Expect = 3.296e-21 Identity = 41/56 (73.21%), Postives = 49/56 (87.50%), Query Frame = 1 Query: 19 SGDDALLRIERIPGIIGISDAPSVRENDAESWHVQIFRSIDSTSVRGFPKDPKEAT 186 S DD+LLRI RIP I+G+S+A S +ND ESWHVQ+FRSIDSTSV+GFPKDP+EAT Sbjct: 471 SFDDSLLRINRIPDIMGLSEASSANDNDPESWHVQVFRSIDSTSVKGFPKDPEEAT 526 HSP 2 Score: 31.187 bits (69), Expect = 3.296e-21 Identity = 12/15 (80.00%), Postives = 15/15 (100.00%), Query Frame = 2 Query: 191 KNLVCGKNVLIDMSI 235 +NL+CGKN+LIDMSI Sbjct: 528 RNLLCGKNILIDMSI 542
BLAST of CF503831 vs. ExPASy Swiss-Prot
Match: PLDB2_ARATH (Phospholipase D beta 2 OS=Arabidopsis thaliana GN=PLDBETA2 PE=2 SV=2) HSP 1 Score: 62.3882 bits (150), Expect = 2.263e-14 Identity = 36/64 (56.25%), Postives = 43/64 (67.19%), Query Frame = 1 Query: 4 IKKLKSG-DDALLRIERIPGIIGISDAPSVRENDAESWHVQIFRSIDSTSVRGFPKDPKEATQQ 192 I KLK+ DDALLRI+RIP I+ + DAP+ IFRSIDS SV+GFPKDPK AT + Sbjct: 543 INKLKTSYDDALLRIDRIPDILRVLDAPT------------IFRSIDSNSVKGFPKDPKYATSK 594 HSP 2 Score: 35.4242 bits (80), Expect = 2.263e-14 Identity = 16/16 (100.00%), Postives = 16/16 (100.00%), Query Frame = 2 Query: 188 SKNLVCGKNVLIDMSI 235 SKNLVCGKNVLIDMSI Sbjct: 593 SKNLVCGKNVLIDMSI 608 The following BLAST results are available for this feature:
BLAST of CF503831 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 5
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CF503831 ID=CF503831; Name=CF503831; organism=Citrus sinensis; type=EST; length=235bpback to top |