CF504571
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CF504571 vs. ExPASy Swiss-Prot
Match: CYPR1_CYNCA (Cyprosin (Fragment) OS=Cynara cardunculus GN=CYPRO1 PE=1 SV=2) HSP 1 Score: 52.7582 bits (125), Expect = 2.891e-12 Identity = 24/35 (68.57%), Postives = 26/35 (74.29%), Query Frame = 3 Query: 3 VGDAVPVWDNMVEQGLVSEEVFSFWLNRDPDA*RG 107 VGDAVPVW M+ QGLV E VFSFWLNR+ D G Sbjct: 168 VGDAVPVWYTMLNQGLVQEPVFSFWLNRNADEQEG 202 HSP 2 Score: 39.2762 bits (90), Expect = 2.891e-12 Identity = 15/17 (88.24%), Postives = 17/17 (100.00%), Query Frame = 1 Query: 100 EEGGEIVFGGVDPNHFK 150 +EGGE+VFGGVDPNHFK Sbjct: 200 QEGGELVFGGVDPNHFK 216
BLAST of CF504571 vs. ExPASy Swiss-Prot
Match: ASPR_CUCPE (Aspartic proteinase OS=Cucurbita pepo PE=2 SV=1) HSP 1 Score: 54.299 bits (129), Expect = 6.315e-12 Identity = 25/35 (71.43%), Postives = 28/35 (80.00%), Query Frame = 3 Query: 3 VGDAVPVWDNMVEQGLVSEEVFSFWLNRDPDA*RG 107 VG+AVPVW NMVEQGLV E VFSFWLNR+ + G Sbjct: 206 VGNAVPVWYNMVEQGLVKEPVFSFWLNRNVEEEEG 240 HSP 2 Score: 36.5798 bits (83), Expect = 6.315e-12 Identity = 14/17 (82.35%), Postives = 16/17 (94.12%), Query Frame = 1 Query: 100 EEGGEIVFGGVDPNHFK 150 EEGGEIVFGGVDP H++ Sbjct: 238 EEGGEIVFGGVDPKHYR 254
BLAST of CF504571 vs. ExPASy Swiss-Prot
Match: ASPR1_ORYSJ (Aspartic proteinase oryzasin-1 OS=Oryza sativa subsp. japonica GN=Os05g0567100 PE=2 SV=2) HSP 1 Score: 55.0694 bits (131), Expect = 1.065e-11 Identity = 26/35 (74.29%), Postives = 26/35 (74.29%), Query Frame = 3 Query: 3 VGDAVPVWDNMVEQGLVSEEVFSFWLNRDPDA*RG 107 VGDAVPVW MVEQGLVSE VFSFW NR D G Sbjct: 202 VGDAVPVWYKMVEQGLVSEPVFSFWFNRHSDEGEG 236 HSP 2 Score: 35.039 bits (79), Expect = 1.065e-11 Identity = 13/16 (81.25%), Postives = 16/16 (100.00%), Query Frame = 1 Query: 103 EGGEIVFGGVDPNHFK 150 EGGEIVFGG+DP+H+K Sbjct: 235 EGGEIVFGGMDPSHYK 250 The following BLAST results are available for this feature:
BLAST of CF504571 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CF504571 ID=CF504571; Name=CF504571; organism=Citrus sinensis; type=EST; length=152bpback to top |