CF510159
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CF510159 vs. ExPASy Swiss-Prot
Match: FAD3C_RICCO (Omega-3 fatty acid desaturase, chloroplastic OS=Ricinus communis GN=FAD7A-1 PE=2 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 4.614e-16 Identity = 35/67 (52.24%), Postives = 46/67 (68.66%), Query Frame = 2 Query: 20 SVSLLAAAMEKERKLKNEVNANGVVE----KGDSFDPAAPPPFKIGEIRAAIPKHCWVKNPWRSLSY 208 +VS ++ ++ER+ NG+V KG+ FD APPPF + +IRAAIPKHCWVKNPWRS+SY Sbjct: 73 NVSTVSGEDDRERE-----EFNGIVNVDEGKGEFFDAGAPPPFTLADIRAAIPKHCWVKNPWRSMSY 134 HSP 2 Score: 30.8018 bits (68), Expect = 4.614e-16 Identity = 9/14 (64.29%), Postives = 10/14 (71.43%), Query Frame = 3 Query: 258 HFNTWFFWPLYWGC 299 +FN W WPLYW C Sbjct: 151 YFNNWVAWPLYWFC 164
BLAST of CF510159 vs. ExPASy Swiss-Prot
Match: FAD3C_SOYBN (Omega-3 fatty acid desaturase, chloroplastic OS=Glycine max GN=FAD7 PE=2 SV=1) HSP 1 Score: 77.0258 bits (188), Expect = 6.000e-16 Identity = 38/65 (58.46%), Postives = 47/65 (72.31%), Query Frame = 2 Query: 20 SVSLLAAAMEKERKLKNEVNA-NGVV-EKGDSFDPAAPPPFKIGEIRAAIPKHCWVKNPWRSLSY 208 S L A++E+E+K + N NGV EK FDP APPPF + +IRAAIPKHCWVK+PWRS+SY Sbjct: 64 SAPLRVASIEEEQKSVDLTNGTNGVEHEKLPEFDPGAPPPFNLADIRAAIPKHCWVKDPWRSMSY 128 HSP 2 Score: 26.9498 bits (58), Expect = 6.000e-16 Identity = 7/12 (58.33%), Postives = 8/12 (66.67%), Query Frame = 3 Query: 258 HFNTWFFWPLYW 293 + N W WPLYW Sbjct: 145 YLNNWLVWPLYW 156
BLAST of CF510159 vs. ExPASy Swiss-Prot
Match: FAD3E_BRANA (Omega-3 fatty acid desaturase, endoplasmic reticulum OS=Brassica napus GN=FAD3 PE=2 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 6.025e-16 Identity = 31/51 (60.78%), Postives = 40/51 (78.43%), Query Frame = 2 Query: 65 KNEVNANGVVEKGDSFDPAAPPPFKIGEIRAAIPKHCWVKNPWRSLSYCTQ 217 ++ VN + K + FDP+A PPFKIG+IRAAIPKHCWVK+P RS+SY T+ Sbjct: 8 RSNVNGDSGARKEEGFDPSAQPPFKIGDIRAAIPKHCWVKSPLRSMSYVTR 58 HSP 2 Score: 30.4166 bits (67), Expect = 6.025e-16 Identity = 8/12 (66.67%), Postives = 11/12 (91.67%), Query Frame = 3 Query: 258 HFNTWFFWPLYW 293 +F++WF WPLYW Sbjct: 72 YFDSWFLWPLYW 83
BLAST of CF510159 vs. ExPASy Swiss-Prot
Match: FAD3C_SESIN (Omega-3 fatty acid desaturase, chloroplastic OS=Sesamum indicum GN=FAD7 PE=2 SV=1) HSP 1 Score: 73.9442 bits (180), Expect = 1.317e-15 Identity = 33/75 (44.00%), Postives = 47/75 (62.67%), Query Frame = 2 Query: 2 ESSFHFSVSLLAAAMEKERKLKNEVNANGVVEKGDSFDPAAPPPFKIGEIRAAIPKHCWVKNPWRSLSYCTQRFA 226 E ++ VS ++ E + +N+ V+ G+ FDP APPPFK+ +IR AIPKHCWVK+PWRS+ Y + A Sbjct: 57 EKNWALRVSAPLRVLQVEEEEENK-EGERVINGGEEFDPGAPPPFKLSDIREAIPKHCWVKDPWRSMGYVVRDVA 130 HSP 2 Score: 28.8758 bits (63), Expect = 1.317e-15 Identity = 8/12 (66.67%), Postives = 9/12 (75.00%), Query Frame = 3 Query: 258 HFNTWFFWPLYW 293 +FN W WPLYW Sbjct: 141 YFNNWVVWPLYW 152
BLAST of CF510159 vs. ExPASy Swiss-Prot
Match: FAD3E_SOYBN (Omega-3 fatty acid desaturase, endoplasmic reticulum OS=Glycine max GN=FAD3 PE=2 SV=1) HSP 1 Score: 79.337 bits (194), Expect = 6.371e-15 Identity = 38/57 (66.67%), Postives = 42/57 (73.68%), Query Frame = 2 Query: 44 MEKERKLKNEVNANGVVEKGDSFD--PAAPPPFKIGEIRAAIPKHCWVKNPWRSLSY 208 M K+ K NG +KG SFD P+APPPFKI EIRA+IPKHCWVKNPWRSLSY Sbjct: 1 MVKDTKPLAYAANNGYQQKGSSFDFDPSAPPPFKIAEIRASIPKHCWVKNPWRSLSY 57 HSP 2 Score: 21.1718 bits (43), Expect = 6.371e-15 Identity = 5/11 (45.45%), Postives = 7/11 (63.64%), Query Frame = 3 Query: 258 HFNTWFFWPLY 290 HF+ W W +Y Sbjct: 74 HFDNWLLWLIY 84
BLAST of CF510159 vs. ExPASy Swiss-Prot
Match: FAD3D_ARATH (Temperature-sensitive omega-3 fatty acid desaturase, chloroplastic OS=Arabidopsis thaliana GN=FAD8 PE=2 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.809e-14 Identity = 28/44 (63.64%), Postives = 33/44 (75.00%), Query Frame = 2 Query: 95 EKGDSFDPAAPPPFKIGEIRAAIPKHCWVKNPWRSLSYCTQRFA 226 E + FDP APPPF + +IRAAIPKHCWVKNPW S+SY + A Sbjct: 76 EDTERFDPGAPPPFNLADIRAAIPKHCWVKNPWMSMSYVVRDVA 119 HSP 2 Score: 29.6462 bits (65), Expect = 1.809e-14 Identity = 8/12 (66.67%), Postives = 9/12 (75.00%), Query Frame = 3 Query: 258 HFNTWFFWPLYW 293 +FN W WPLYW Sbjct: 130 YFNNWLLWPLYW 141
BLAST of CF510159 vs. ExPASy Swiss-Prot
Match: FAD3C_BRANA (Omega-3 fatty acid desaturase, chloroplastic (Fragment) OS=Brassica napus GN=FAD7 PE=2 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 2.355e-14 Identity = 29/50 (58.00%), Postives = 36/50 (72.00%), Query Frame = 2 Query: 98 KGDSFDPAAPPPFKIGEIRAAIPKHCWVKNPWRSLSYCTQRFACGSCIAS 247 K FDP APPPF + +IRAAIPKHCWVKNPW+S+SY + A +A+ Sbjct: 42 KTQRFDPGAPPPFNLADIRAAIPKHCWVKNPWKSMSYVVRELAIVFALAA 91 HSP 2 Score: 26.9498 bits (58), Expect = 2.355e-14 Identity = 7/12 (58.33%), Postives = 8/12 (66.67%), Query Frame = 3 Query: 258 HFNTWFFWPLYW 293 + N W WPLYW Sbjct: 95 YLNNWLVWPLYW 106
BLAST of CF510159 vs. ExPASy Swiss-Prot
Match: FAD3E_ARATH (Omega-3 fatty acid desaturase, endoplasmic reticulum OS=Arabidopsis thaliana GN=FAD3 PE=2 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 3.981e-14 Identity = 33/71 (46.48%), Postives = 47/71 (66.20%), Query Frame = 2 Query: 32 LAAAMEKERKLKNEVNANGVVEKGDSFDPAAPPPFKIGEIRAAIPKHCWVKNPWRSLSYCTQRFACGSCIA 244 + AM++ + + A G +K + FDP+A PPFKIG+IRAAIPKHCWVK+P RS+SY + + +A Sbjct: 1 MVVAMDQRTNVNGDPGA-GDRKKEERFDPSAQPPFKIGDIRAAIPKHCWVKSPLRSMSYVVRDIIAVAALA 70 HSP 2 Score: 27.7202 bits (60), Expect = 3.981e-14 Identity = 7/12 (58.33%), Postives = 10/12 (83.33%), Query Frame = 3 Query: 258 HFNTWFFWPLYW 293 + ++WF WPLYW Sbjct: 75 YVDSWFLWPLYW 86
BLAST of CF510159 vs. ExPASy Swiss-Prot
Match: FAD3C_ARATH (Omega-3 fatty acid desaturase, chloroplastic OS=Arabidopsis thaliana GN=FAD7 PE=1 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 5.151e-14 Identity = 29/46 (63.04%), Postives = 35/46 (76.09%), Query Frame = 2 Query: 110 FDPAAPPPFKIGEIRAAIPKHCWVKNPWRSLSYCTQRFACGSCIAS 247 FDP APPPF + +IRAAIPKHCWVKNPW+SLSY + A +A+ Sbjct: 88 FDPGAPPPFNLADIRAAIPKHCWVKNPWKSLSYVVRDVAIVFALAA 133 HSP 2 Score: 26.9498 bits (58), Expect = 5.151e-14 Identity = 7/12 (58.33%), Postives = 8/12 (66.67%), Query Frame = 3 Query: 258 HFNTWFFWPLYW 293 + N W WPLYW Sbjct: 137 YLNNWIVWPLYW 148
BLAST of CF510159 vs. ExPASy Swiss-Prot
Match: FAD3E_PHAAU (Omega-3 fatty acid desaturase, endoplasmic reticulum OS=Phaseolus aureus GN=ARG1 PE=2 SV=1) HSP 1 Score: 62.7734 bits (151), Expect = 8.732e-14 Identity = 32/60 (53.33%), Postives = 38/60 (63.33%), Query Frame = 2 Query: 83 NGVVEKGDS-FDPAAPPPFKIGEIRAAIPKHCWVKNPWRSLSYCTQRFACGSCIASCCYS 259 NG E S FDP APPPFKI +IRAAIPKHCW K+ RSLSY + + +A+ S Sbjct: 12 NGAREGDQSYFDPGAPPPFKIADIRAAIPKHCWEKSTLRSLSYVLRDVLVVTALAASAIS 71 HSP 2 Score: 33.8834 bits (76), Expect = 8.732e-14 Identity = 10/11 (90.91%), Postives = 11/11 (100.00%), Query Frame = 3 Query: 261 FNTWFFWPLYW 293 FN+WFFWPLYW Sbjct: 72 FNSWFFWPLYW 82 The following BLAST results are available for this feature:
BLAST of CF510159 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 11
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CF510159 ID=CF510159; Name=CF510159; organism=Citrus sinensis; type=EST; length=316bpback to top |