CF834554
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CF834554 vs. ExPASy Swiss-Prot
Match: ISAM1_ARATH (Iron-sulfur assembly protein IscA-like 1, mitochondrial OS=Arabidopsis thaliana GN=At2g16710 PE=2 SV=2) HSP 1 Score: 83.9593 bits (206), Expect = 5.224e-16 Identity = 38/49 (77.55%), Postives = 42/49 (85.71%), Query Frame = -3 Query: 399 KGVKILIDPKVFMPVIGAKMDFVDDKLRSGLVFINPNFKGQCGCGESFM 545 KGV+IL++PK M VIG KMDFVDDKLRS VFINPN +GQCGCGESFM Sbjct: 77 KGVRILVEPKALMHVIGTKMDFVDDKLRSEFVFINPNSQGQCGCGESFM 125
BLAST of CF834554 vs. ExPASy Swiss-Prot
Match: ISAM3_ARATH (Iron-sulfur assembly protein IscA-like 3, mitochondrial OS=Arabidopsis thaliana GN=At2g36260 PE=3 SV=2) HSP 1 Score: 73.1738 bits (178), Expect = 9.222e-13 Identity = 35/48 (72.92%), Postives = 39/48 (81.25%), Query Frame = -3 Query: 402 KGVKILIDPKVFMPVIGAKMDFVDDKLRSGLVFINPNFKGQCGCGESF 545 KGVKIL+DPK M VIG +MDFVDDKLRS VF+NPN +CGCGESF Sbjct: 60 KGVKILVDPKAVMHVIGTEMDFVDDKLRSEFVFVNPN-ATKCGCGESF 106
BLAST of CF834554 vs. ExPASy Swiss-Prot
Match: ISA1_YEAST (Iron sulfur assembly protein 1 OS=Saccharomyces cerevisiae GN=ISA1 PE=1 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 1.020e-11 Identity = 31/48 (64.58%), Postives = 37/48 (77.08%), Query Frame = -3 Query: 399 GVKILIDPKVFMPVIGAKMDFVDDKLRSGLVFINPNFKGQCGCGESFM 542 GVKI+ID K +IG++MD++DDKL S VF NPN KG CGCGESFM Sbjct: 202 GVKIVIDSKALFSIIGSEMDWIDDKLASKFVFKNPNSKGTCGCGESFM 249 The following BLAST results are available for this feature:
BLAST of CF834554 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CF834554 ID=CF834554; Name=CF834554; organism=Citrus sinensis; type=EST; length=547bpback to top |