CF834771
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CF834771 vs. ExPASy Swiss-Prot
Match: ATP5E_ARATH (ATP synthase subunit epsilon, mitochondrial OS=Arabidopsis thaliana GN=At1g51650 PE=1 SV=3) HSP 1 Score: 125.561 bits (314), Expect = 1.676e-28 Identity = 55/62 (88.71%), Postives = 59/62 (95.16%), Query Frame = -1 Query: 374 PFWRAAGMTYISYSNICANLVRNCLKEPYKTEALTREKVHFSISKWTDGKPQKPTIRSDTPE 559 PFWRAAGMTYISYSNICAN+VRNCLKEP+K EALTREKVHFS+SKW DGKPQKP +RSDTPE Sbjct: 8 PFWRAAGMTYISYSNICANIVRNCLKEPHKAEALTREKVHFSLSKWADGKPQKPVLRSDTPE 69
BLAST of CF834771 vs. ExPASy Swiss-Prot
Match: ATP5E_IPOBA (ATP synthase subunit epsilon, mitochondrial OS=Ipomoea batatas PE=1 SV=2) HSP 1 Score: 121.324 bits (303), Expect = 3.161e-27 Identity = 53/63 (84.13%), Postives = 58/63 (92.06%), Query Frame = -1 Query: 371 PFWRAAGMTYISYSNICANLVRNCLKEPYKTEALTREKVHFSISKWTDGKPQKPTIRSDTPEE 559 PFWRAAGMTYI+YSN+CAN+VRNCLKEPY+ EAL+REKVHFS SKW DGKPQKP IRSDT EE Sbjct: 8 PFWRAAGMTYITYSNLCANMVRNCLKEPYRAEALSREKVHFSFSKWVDGKPQKPAIRSDTGEE 70
BLAST of CF834771 vs. ExPASy Swiss-Prot
Match: ATP5E_MAIZE (ATP synthase subunit epsilon, mitochondrial OS=Zea mays PE=3 SV=1) HSP 1 Score: 111.309 bits (277), Expect = 3.271e-24 Identity = 48/62 (77.42%), Postives = 57/62 (91.94%), Query Frame = -1 Query: 374 PFWRAAGMTYISYSNICANLVRNCLKEPYKTEALTREKVHFSISKWTDGKPQKPTIRSDTPE 559 PFWRAAGMTYI YSNICA LVRNCLKEP+K+EA +REKVHFSISKWTDGK +KPT+R+++ + Sbjct: 9 PFWRAAGMTYIGYSNICAALVRNCLKEPFKSEAASREKVHFSISKWTDGKQEKPTVRTESDD 70 The following BLAST results are available for this feature:
BLAST of CF834771 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CF834771 ID=CF834771; Name=CF834771; organism=Citrus sinensis; type=EST; length=559bpback to top |