CF836141
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CF836141 vs. ExPASy Swiss-Prot
Match: WRK31_ARATH (Probable WRKY transcription factor 31 OS=Arabidopsis thaliana GN=WRKY31 PE=2 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 1.879e-16 Identity = 48/88 (54.55%), Postives = 60/88 (68.18%), Query Frame = 2 Query: 335 RVAVDEVDFFSDDKNRVSISDHREDDRNKTTNSVHIKKENSHDQLRHRTGLDVNTGLHLLTAANTGSDQSTVDDGVSSDHADEKRTKI 598 RV VDEVDFFS+ ++RVS + +DD N V IK E S + R+ DVN GL+LLTA NTGSD+STVDDG+S D ++KR KI Sbjct: 27 RVVVDEVDFFSEKRDRVSRENINDDDDEG--NKVLIKMEGSRVEENDRSR-DVNIGLNLLTA-NTGSDESTVDDGLSMD-MEDKRAKI 109 HSP 2 Score: 31.5722 bits (70), Expect = 1.879e-16 Identity = 13/17 (76.47%), Postives = 15/17 (88.24%), Query Frame = 3 Query: 642 KNQRLRDMLSQVTNNYN 692 +NQRLRDMLSQ T N+N Sbjct: 124 ENQRLRDMLSQATTNFN 140
BLAST of CF836141 vs. ExPASy Swiss-Prot
Match: WRK42_ARATH (Probable WRKY transcription factor 42 OS=Arabidopsis thaliana GN=WRKY42 PE=2 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 3.544e-14 Identity = 42/88 (47.73%), Postives = 56/88 (63.64%), Query Frame = 2 Query: 335 RVAVDEVDFFSDDKNRVSISDHREDDRNKTTNSVHIKKENSH-DQLRHRTGLDVNTGLHLLTAANTGSDQSTVDDGVSSDHADEKRTK 595 R V+EVDFF + R +S ++ T+ VH+K+ENS D R+ +N GL+LLT ANTGSD+S VDDG+S D +EKRTK Sbjct: 25 RAVVNEVDFFRSAEKRDRVSREEQNIIADETHRVHVKRENSRVDDHDDRSTDHINIGLNLLT-ANTGSDESMVDDGLSVD-MEEKRTK 110 HSP 2 Score: 30.4166 bits (67), Expect = 3.544e-14 Identity = 12/18 (66.67%), Postives = 15/18 (83.33%), Query Frame = 3 Query: 639 QKNQRLRDMLSQVTNNYN 692 + NQRL+ MLSQ TNN+N Sbjct: 125 EDNQRLKQMLSQTTNNFN 142 The following BLAST results are available for this feature:
BLAST of CF836141 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CF836141 ID=CF836141; Name=CF836141; organism=Citrus sinensis; type=EST; length=694bpback to top |