CK739797
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CK739797 vs. ExPASy Swiss-Prot
Match: ALFC1_ARATH (Probable fructose-bisphosphate aldolase 1, chloroplastic OS=Arabidopsis thaliana GN=FBA1 PE=1 SV=2) HSP 1 Score: 73.559 bits (179), Expect = 3.631e-13 Identity = 36/39 (92.31%), Postives = 37/39 (94.87%), Query Frame = 2 Query: 2 AAQDTLLTRAKANSLAQLGKYTGEGESEEAKKGMFVKGY 118 AAQD LL RAKANSLAQLGKYTGEGESEEAK+GMFVKGY Sbjct: 359 AAQDILLARAKANSLAQLGKYTGEGESEEAKEGMFVKGY 397
BLAST of CK739797 vs. ExPASy Swiss-Prot
Match: ALFC2_ARATH (Probable fructose-bisphosphate aldolase 2, chloroplastic OS=Arabidopsis thaliana GN=FBA2 PE=1 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 4.742e-13 Identity = 36/39 (92.31%), Postives = 37/39 (94.87%), Query Frame = 2 Query: 2 AAQDTLLTRAKANSLAQLGKYTGEGESEEAKKGMFVKGY 118 AAQ TLL RAKANSLAQLGKYTGEGESEEAK+GMFVKGY Sbjct: 358 AAQTTLLARAKANSLAQLGKYTGEGESEEAKEGMFVKGY 396
BLAST of CK739797 vs. ExPASy Swiss-Prot
Match: ALFC3_ARATH (Probable fructose-bisphosphate aldolase 3, chloroplastic OS=Arabidopsis thaliana GN=FBA3 PE=1 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.888e-11 Identity = 31/39 (79.49%), Postives = 35/39 (89.74%), Query Frame = 2 Query: 2 AAQDTLLTRAKANSLAQLGKYTGEGESEEAKKGMFVKGY 118 A+Q LL RAKANSLAQLGKY+ EGE+E+AKKGMFVKGY Sbjct: 351 ASQKALLVRAKANSLAQLGKYSAEGENEDAKKGMFVKGY 389 The following BLAST results are available for this feature:
BLAST of CK739797 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CK739797 ID=CK739797; Name=CK739797; organism=Citrus sinensis; type=EST; length=296bpback to top |