CK932758
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CK932758 vs. ExPASy Swiss-Prot
Match: ASO_CUCMA (L-ascorbate oxidase OS=Cucurbita maxima GN=AAO PE=1 SV=2) HSP 1 Score: 77.0258 bits (188), Expect = 3.245e-14 Identity = 31/36 (86.11%), Postives = 34/36 (94.44%), Query Frame = 1 Query: 133 HYKWEVEYMFWSPDCKESILMGINGQFPGPTIRARA 240 HYKWEVEYMFW+PDC E+I+MGINGQFPGPTIRA A Sbjct: 35 HYKWEVEYMFWAPDCNENIVMGINGQFPGPTIRANA 70
BLAST of CK932758 vs. ExPASy Swiss-Prot
Match: ASO_CUCSA (L-ascorbate oxidase OS=Cucumis sativus PE=1 SV=1) HSP 1 Score: 75.485 bits (184), Expect = 9.441e-14 Identity = 31/39 (79.49%), Postives = 35/39 (89.74%), Query Frame = 1 Query: 124 KPAHYKWEVEYMFWSPDCKESILMGINGQFPGPTIRARA 240 K HYKW+VEYMFWSPDC E+I+MGING+FPGPTIRA A Sbjct: 37 KIKHYKWDVEYMFWSPDCVENIVMGINGEFPGPTIRANA 75
BLAST of CK932758 vs. ExPASy Swiss-Prot
Match: ASO_CUCPM (L-ascorbate oxidase OS=Cucurbita pepo var. melopepo PE=1 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 1.233e-13 Identity = 30/36 (83.33%), Postives = 34/36 (94.44%), Query Frame = 1 Query: 133 HYKWEVEYMFWSPDCKESILMGINGQFPGPTIRARA 240 HYKWEVEYMFW+P+C E+I+MGINGQFPGPTIRA A Sbjct: 5 HYKWEVEYMFWAPNCNENIVMGINGQFPGPTIRANA 40
BLAST of CK932758 vs. ExPASy Swiss-Prot
Match: ASO_TOBAC (L-ascorbate oxidase OS=Nicotiana tabacum GN=AAO PE=2 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 5.180e-12 Identity = 28/39 (71.79%), Postives = 35/39 (89.74%), Query Frame = 1 Query: 124 KPAHYKWEVEYMFWSPDCKESILMGINGQFPGPTIRARA 240 K H+KW+VEY+ WSPD +ES++MGINGQFPGPTIRA+A Sbjct: 29 KTRHFKWDVEYIHWSPDGEESVVMGINGQFPGPTIRAKA 67 The following BLAST results are available for this feature:
BLAST of CK932758 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 4
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CK932758 ID=CK932758; Name=CK932758; organism=Citrus sinensis; type=EST; length=241bpback to top |