CK933908

Overview
NameCK933908
Unique NameCK933908
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length502
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CK933908 vs. ExPASy Swiss-Prot
Match: RS43_ARATH (40S ribosomal protein S4-3 OS=Arabidopsis thaliana GN=RPS4D PE=2 SV=2)

HSP 1 Score: 248.825 bits (634), Expect = 1.010e-65
Identity = 118/125 (94.40%), Postives = 123/125 (98.40%), Query Frame = 3
Query:  126 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCK 500
            MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYREVI+ILMQRH+ VD KVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSI+DEEAKFKLCK
Sbjct:    1 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAKFKLCK 125          
BLAST of CK933908 vs. ExPASy Swiss-Prot
Match: RS42_ARATH (40S ribosomal protein S4-2 OS=Arabidopsis thaliana GN=RPS4B PE=2 SV=4)

HSP 1 Score: 248.825 bits (634), Expect = 1.010e-65
Identity = 118/125 (94.40%), Postives = 123/125 (98.40%), Query Frame = 3
Query:  126 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCK 500
            MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYREVI+ILMQRH+ VD KVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSI+DEEAKFKLCK
Sbjct:    1 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAKFKLCK 125          
BLAST of CK933908 vs. ExPASy Swiss-Prot
Match: RS41_ARATH (40S ribosomal protein S4-1 OS=Arabidopsis thaliana GN=RPS4A PE=2 SV=1)

HSP 1 Score: 248.825 bits (634), Expect = 1.010e-65
Identity = 118/125 (94.40%), Postives = 123/125 (98.40%), Query Frame = 3
Query:  126 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCK 500
            MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYREVI+ILMQRH+ VD KVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSI+DEEAKFKLCK
Sbjct:    1 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAKFKLCK 125          
BLAST of CK933908 vs. ExPASy Swiss-Prot
Match: RS4_MAIZE (40S ribosomal protein S4 OS=Zea mays GN=RPS4 PE=2 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 1.319e-65
Identity = 118/125 (94.40%), Postives = 123/125 (98.40%), Query Frame = 3
Query:  126 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCK 500
            MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILI+RNRLKYALTYREVI+ILMQRHVLVD KVRTDKTYPAGFMDV+SIPKTNEN+RLLYDTKGRFRLH IRDE+AKFKLCK
Sbjct:    1 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYREVISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTNENYRLLYDTKGRFRLHPIRDEDAKFKLCK 125          
BLAST of CK933908 vs. ExPASy Swiss-Prot
Match: RS4_SOLTU (40S ribosomal protein S4 OS=Solanum tuberosum GN=RPS4 PE=2 SV=1)

HSP 1 Score: 246.128 bits (627), Expect = 6.547e-65
Identity = 116/125 (92.80%), Postives = 123/125 (98.40%), Query Frame = 3
Query:  126 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCK 500
            MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKYALTYREVI+ILMQR V+VD KVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHS+RDEE+KFKLCK
Sbjct:    1 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIIMRNRLKYALTYREVISILMQRQVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEESKFKLCK 125          
BLAST of CK933908 vs. ExPASy Swiss-Prot
Match: RS4_ORYSJ (40S ribosomal protein S4 OS=Oryza sativa subsp. japonica GN=RPS4 PE=2 SV=3)

HSP 1 Score: 243.432 bits (620), Expect = 4.244e-64
Identity = 115/125 (92.00%), Postives = 122/125 (97.60%), Query Frame = 3
Query:  126 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCK 500
            MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILI+RNRLKYALTYREVI+ILMQRHVLVD KVRTDKTYPAGFMDV+SIPKT EN+RLLYDTKGRFRL S++DE+AKFKLCK
Sbjct:    1 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYREVISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTGENYRLLYDTKGRFRLQSVKDEDAKFKLCK 125          
BLAST of CK933908 vs. ExPASy Swiss-Prot
Match: RS4_GOSHI (40S ribosomal protein S4 OS=Gossypium hirsutum GN=RPS4 PE=2 SV=1)

HSP 1 Score: 239.195 bits (609), Expect = 8.003e-63
Identity = 115/125 (92.00%), Postives = 120/125 (96.00%), Query Frame = 3
Query:  126 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCK 500
            MARGLKKHLKRLNAP+HWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHV+VD KVRTDKTYPAGFMDVVSIPKTNE+FRLLYDTKGRF LH+I  +E KFKLCK
Sbjct:    1 MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFCLHAITGDETKFKLCK 125          
BLAST of CK933908 vs. ExPASy Swiss-Prot
Match: RS4_PRUAR (40S ribosomal protein S4 OS=Prunus armeniaca GN=RPS4 PE=2 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 2.946e-57
Identity = 108/125 (86.40%), Postives = 114/125 (91.20%), Query Frame = 3
Query:  126 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCK 500
            MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREV++ILMQRH+LVD K+     +     DVVSIPKTNENFRLLYDTKGRFRLHSIRDEE+KFKLCK
Sbjct:    1 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVVSILMQRHILVDGKIH----FCIRLSDVVSIPKTNENFRLLYDTKGRFRLHSIRDEESKFKLCK 121          
BLAST of CK933908 vs. ExPASy Swiss-Prot
Match: RS4_BOMMO (40S ribosomal protein S4 OS=Bombyx mori GN=RpS4 PE=2 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 4.555e-50
Identity = 94/125 (75.20%), Postives = 105/125 (84.00%), Query Frame = 3
Query:  126 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCK 500
            MARG KKHLKRLNAPK WMLDKLGG +AP+PS+GPHK RECLPL++ LRNRLKYALT  EV+ I+ QR + VD KVRTD TYPAGFMDVVSI KTNE FRL+YD KGRF +H I  EEAK+KLCK
Sbjct:    1 MARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNEVLKIVKQRLIKVDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCK 125          
BLAST of CK933908 vs. ExPASy Swiss-Prot
Match: RS4_SPOFR (40S ribosomal protein S4 OS=Spodoptera frugiperda GN=RpS4 PE=2 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 5.949e-50
Identity = 94/125 (75.20%), Postives = 105/125 (84.00%), Query Frame = 3
Query:  126 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCK 500
            MARG KKHLKRLNAPK WMLDKLGG +AP+PS+GPHK RECLPL++ LRNRLKYALT  EV+ I+ QR + VD KVRTD TYPAGFMDVVSI KTNE FRL+YD KGRF +H I  EEAK+KLCK
Sbjct:    1 MARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNEVLKIVKQRLIKVDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTVHRITPEEAKYKLCK 125          
The following BLAST results are available for this feature:
BLAST of CK933908 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 98
Match NameE-valueIdentityDescription
RS43_ARATH1.010e-6594.4040S ribosomal protein S4-3 OS=Arabidopsis thaliana... [more]
RS42_ARATH1.010e-6594.4040S ribosomal protein S4-2 OS=Arabidopsis thaliana... [more]
RS41_ARATH1.010e-6594.4040S ribosomal protein S4-1 OS=Arabidopsis thaliana... [more]
RS4_MAIZE1.319e-6594.4040S ribosomal protein S4 OS=Zea mays GN=RPS4 PE=2 ... [more]
RS4_SOLTU6.547e-6592.8040S ribosomal protein S4 OS=Solanum tuberosum GN=R... [more]
RS4_ORYSJ4.244e-6492.0040S ribosomal protein S4 OS=Oryza sativa subsp. ja... [more]
RS4_GOSHI8.003e-6392.0040S ribosomal protein S4 OS=Gossypium hirsutum GN=... [more]
RS4_PRUAR2.946e-5786.4040S ribosomal protein S4 OS=Prunus armeniaca GN=RP... [more]
RS4_BOMMO4.555e-5075.2040S ribosomal protein S4 OS=Bombyx mori GN=RpS4 PE... [more]
RS4_SPOFR5.949e-5075.2040S ribosomal protein S4 OS=Spodoptera frugiperda ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004543_G05 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10003_IIF_G05 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK933908 ID=CK933908|Name=CK933908|organism=Citrus sinensis|type=EST|length=502bp
GGGGAATGTTAGGGCCTNNNNGGAGTGGAGCTAGCAGCGCTTGTGAGTGC
ATTTCACTTCGTTTTTGTTTTGCAGGACTGTGACACGCCGTTGGCGAATC
CAAGCTCAGGCTCACGAACACAAAAATGGCGAGAGGTTTGAAGAAACATT
TGAAGAGGCTTAATGCCCCAAAGCACTGGATGCTTGACAAACTTGGTGGA
GCATTTGCTCCCAAGCCTTCATCTGGGCCACACAAATCAAGGGAGTGTTT
GCCCTTAATTCTTATCTTACGTAACCGCTTGAAGTATGCTCTTACATACC
GAGAAGTCATTGCAATTTTGATGCAACGACATGTGTTGGTTGATGCTAAG
GTTCGCACAGATAAGACTTACCCTGCTGGGTTCATGGATGTTGTGTCAAT
TCCAAAGACGAATGAGAACTTCCGTCTCCTTTACGACACCAAGGGCCGGT
TCCGCCTTCATTCAATCAGGGATGAGGAGGCTAAGTTCAAGCTCTGCAAG
GT
back to top