CK933909

Overview
NameCK933909
Unique NameCK933909
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length796
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CK933909 vs. ExPASy Swiss-Prot
Match: GEML8_ARATH (Putative GEM-like protein 8 OS=Arabidopsis thaliana GN=At5g23370 PE=3 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 6.067e-51
Identity = 97/172 (56.40%), Postives = 129/172 (75.00%), Query Frame = 2
Query:  257 TEMGQRKCIESKGSNFACRIRDHVKMGPKFSETVKSKLSLGAKIIQKGGRENIFKQIFGLTEGEEFLKASQCYLSTTRGPIAGLLFISNKKIAFCSERSISYSSSTGELIRTPYKVLIPIQKIKSIDESENVNKPEQKYVEIVTVDDFEFWFMGFLRYEKAYRNLQKAISMA 772
            T  G+    + K  +F   +RD  K+GPK +ETVK KLSLGA+I+Q GG E I+K++F +++ E+  KA QCYLSTT GPIAGLLFIS+KKIAFCSERSI  +S  GEL R  YKV IP+ KI  +++S+N  KP QKY+E+VTVD F+FWFMGFL Y+KA+  L++A+S++
Sbjct:   45 TGKGKSMLRKKKNDSFTNGVRDQDKLGPKLTETVKRKLSLGARILQMGGLEKIYKRLFKVSDEEKLFKAYQCYLSTTAGPIAGLLFISSKKIAFCSERSIKVASPQGELNRVHYKVSIPLCKINGVNQSQNTTKPSQKYLEVVTVDGFDFWFMGFLSYQKAFNCLEQALSLS 216          
BLAST of CK933909 vs. ExPASy Swiss-Prot
Match: GEML4_ARATH (GEM-like protein 4 OS=Arabidopsis thaliana GN=At5g08350 PE=2 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 1.352e-50
Identity = 100/181 (55.25%), Postives = 130/181 (71.82%), Query Frame = 2
Query:  242 ADEEDTEMGQRKCI--ESKGSNFACRIRDHVKMGPKFSETVKSKLSLGAKIIQKGGRENIFKQIFGLTEGEEFLKASQCYLSTTRGPIAGLLFISNKKIAFCSERSISYSSSTGELIRTPYKVLIPIQKIKSIDESENVNKPEQKYVEIVTVDDFEFWFMGFLRYEKAYRNLQKAISMANE 778
            A  + +E    K I    K   F   +RD  K+ PK +ETVK KLSLGA+I+Q GG E IFK++F ++EGE+  K  QCYLSTT GPIAGLLFIS+KK+AFCSERSI   S  G++IR  YKV IP+ KI  +++S+N  KP QKY+E+VTVD F+FWFMGFL Y+KA+  L+KA+S++ E
Sbjct:   37 ASSKKSEQSNVKSILKRKKTDGFTNGVRDQSKIRPKLTETVKRKLSLGARILQVGGLEKIFKRLFRVSEGEKLFKMYQCYLSTTAGPIAGLLFISSKKMAFCSERSIKVDSPQGDIIRVHYKVSIPLCKIDRVNQSQNTKKPSQKYLEVVTVDGFDFWFMGFLSYQKAFNCLEKALSLSFE 217          
BLAST of CK933909 vs. ExPASy Swiss-Prot
Match: GEML6_ARATH (GEM-like protein 6 OS=Arabidopsis thaliana GN=At5g23350 PE=2 SV=2)

HSP 1 Score: 195.667 bits (496), Expect = 2.549e-49
Identity = 96/170 (56.47%), Postives = 125/170 (73.53%), Query Frame = 2
Query:  257 TEMGQRKCIESKGSNFACRIRDHVKMGPKFSETVKSKLSLGAKIIQKGGRENIFKQIFGLTEGEEFLKASQCYLSTTRGPIAGLLFISNKKIAFCSERSISYSSSTGELIRTPYKVLIPIQKIKSIDESENVNKPEQKYVEIVTVDDFEFWFMGFLRYEKAYRNLQKAIS 766
            T  G+    + K  +F    RD  K+GPK +ETVK KLSLGAKI+Q GG E I+K++F + + E+  KA QCYLSTT GPIAGLLFIS+KKIAFCSERSI  +S  G L R  YKV IP+ KI  +++S+N  KP QKY+EIVT+D+F+FWFMGF+ Y+KA+  L+KA++
Sbjct:   45 TGKGKSMLRKKKTDSFTNGARDQDKLGPKLTETVKRKLSLGAKILQMGGLEKIYKRLFKVCDQEKLFKAYQCYLSTTAGPIAGLLFISSKKIAFCSERSIKVASPQGVLSRVHYKVSIPLCKINGVNQSQNTKKPSQKYLEIVTIDNFDFWFMGFVSYQKAFNCLEKALN 214          
BLAST of CK933909 vs. ExPASy Swiss-Prot
Match: GEML7_ARATH (GEM-like protein 7 OS=Arabidopsis thaliana GN=At5g23360 PE=2 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 4.807e-48
Identity = 91/161 (56.52%), Postives = 122/161 (75.78%), Query Frame = 2
Query:  284 ESKGSNFACRIRDHVKMGPKFSETVKSKLSLGAKIIQKGGRENIFKQIFGLTEGEEFLKASQCYLSTTRGPIAGLLFISNKKIAFCSERSISYSSSTGELIRTPYKVLIPIQKIKSIDESENVNKPEQKYVEIVTVDDFEFWFMGFLRYEKAYRNLQKAIS 766
            + K  +F    RD  K+GPK +ETVK KLSLGAKI+Q GG E I+K++F + + E+  KA QCYLSTT G IAGLLFIS+KKIAFCSERSI  +S  G+L R  YKV IP+ KI  +++S+N  KP Q+Y+E+VTVD+++FWFMGF+ Y+KA+  L+KA++
Sbjct:   46 KKKTDSFTNGARDQDKLGPKLTETVKRKLSLGAKILQMGGLEKIYKRLFKVCDKEKLFKAYQCYLSTTEGSIAGLLFISSKKIAFCSERSIKVTSPQGDLTRVHYKVSIPLCKINGVNQSQNTKKPSQRYLEVVTVDNYDFWFMGFVSYQKAFNCLEKALN 206          
BLAST of CK933909 vs. ExPASy Swiss-Prot
Match: GEML2_ARATH (GEM-like protein 2 OS=Arabidopsis thaliana GN=At4g01600 PE=2 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 5.705e-33
Identity = 68/151 (45.03%), Postives = 102/151 (67.55%), Query Frame = 2
Query:  314 IRDHVKMGPKFSETVKSKLSLGAKIIQKGGRENIFKQIFGLTEGEEFLKASQCYLSTTRGPIAGLLFISNKKIAFCSERSISY-SSSTGELIRTPYKVLIPIQKIKSIDESENVNKPEQKYVEIVTVDDFEFWFMGFLRYEKAYRNLQKAI 763
            ++DH+K  P  S+   ++LS G K+I +GG E +F++ FG+   E+ L +  CY+STT GP+ G+++ISN++IAFCS+ +I   SS+ G  +   YKV++  +KI SI  S NV KP ++YV +VT D FEFWFMGF+ Y  A+  L KA+
Sbjct:   74 LKDHLKFSPSISDAAMARLSQGTKMIVEGGPERVFQREFGVLAVEKLLDSFVCYISTTSGPVTGVIYISNRRIAFCSDYAIRLPSSAGGNGVAAYYKVVMEWEKISSISSSTNVLKPSERYVHMVTRDGFEFWFMGFVSYIDAFNCLNKAL 224          
BLAST of CK933909 vs. ExPASy Swiss-Prot
Match: GEML5_ARATH (GEM-like protein 5 OS=Arabidopsis thaliana GN=At5g13200 PE=1 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 3.698e-32
Identity = 63/159 (39.62%), Postives = 102/159 (64.15%), Query Frame = 2
Query:  290 KGSNFACRIRDHVKMGPKFSETVKSKLSLGAKIIQKGGRENIFKQIFGLTEGEEFLKASQCYLSTTRGPIAGLLFISNKKIAFCSERSISYSSSTGELIRTPYKVLIPIQKIKSIDESENVNKPEQKYVEIVTVDDFEFWFMGFLRYEKAYRNLQKAIS 766
            K    A  +  ++K GP  SET   K++L AK I KGG E++F+QIFG    E   K   CYLSTT GP+AG +++SN ++AFCS+R + +++ +G+   + Y+V++P+  + +++       P +KY+++ TVD  +FWFMGF+ YEKA  +L  ++S
Sbjct:  103 KAETVARNLWHNLKTGPSMSETAWGKVNLTAKAITKGGFESLFRQIFGTEPNETLKKTFACYLSTTTGPVAGTVYLSNARVAFCSDRPLYFTAPSGQESWSYYRVVVPLANVATVNPVVVKETPPEKYIQLTTVDGHDFWFMGFVNYEKATHHLLTSVS 261          
BLAST of CK933909 vs. ExPASy Swiss-Prot
Match: GEML1_ARATH (GEM-like protein 1 OS=Arabidopsis thaliana GN=FIP1 PE=1 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 1.007e-29
Identity = 57/158 (36.08%), Postives = 100/158 (63.29%), Query Frame = 2
Query:  290 KGSNFACRIRDHVKMGPKFSETVKSKLSLGAKIIQKGGRENIFKQIFGLTEGEEFLKASQCYLSTTRGPIAGLLFISNKKIAFCSERSISYSSSTGELIRTPYKVLIPIQKIKSIDESENVNKPEQKYVEIVTVDDFEFWFMGFLRYEKAYRNLQKAI 763
            K  + A     H+K GP  ++   S+++ G KI+ +GG E +FKQ F     E+ LK   CYLST+ GP+ G++++S  K+AF S+  +SY     + + + YKV++P  ++K+++ S +      KY++++++D+ EFWFMGF+ YE A ++LQ+A+
Sbjct:   98 KAEDLAGNFWQHLKTGPSVADAAVSRIAQGTKILAEGGYEKVFKQTFDCLPDEKLLKTYACYLSTSAGPVLGVMYLSTHKLAFSSDNPLSYKEGE-QTLWSYYKVVLPANQLKAVNPSTSRVNTSDKYIQVISIDNHEFWFMGFVTYESAVKSLQEAV 254          
BLAST of CK933909 vs. ExPASy Swiss-Prot
Match: GEM_ARATH (GLABRA2 expression modulator OS=Arabidopsis thaliana GN=GEM PE=1 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 3.827e-29
Identity = 56/158 (35.44%), Postives = 101/158 (63.92%), Query Frame = 2
Query:  290 KGSNFACRIRDHVKMGPKFSETVKSKLSLGAKIIQKGGRENIFKQIFGLTEGEEFLKASQCYLSTTRGPIAGLLFISNKKIAFCSERSISYSSSTGELIRTPYKVLIPIQKIKSIDESENVNKPEQKYVEIVTVDDFEFWFMGFLRYEKAYRNLQKAI 763
            K  + A     H++  P F++    +++   K+  +GG E IF+Q F     E+ L +  CYLST+ GP+ G+L+IS+ K+A+CS+  +SY +   +   + YKV+IP+ ++K+++ S ++  P +KY+++++VD+ EFWFMGFL Y+ A  +LQ ++
Sbjct:  135 KTESLAGNTWQHLRTAPSFADAAMGRIAQSTKVFAEGGYEKIFRQTFETDPEEQLLNSFACYLSTSAGPVMGVLYISSAKLAYCSDNPLSYKNG-DQTEWSYYKVVIPLHQLKAVNPSASIVNPAEKYIQVISVDNHEFWFMGFLNYDGAVTSLQDSL 291          
BLAST of CK933909 vs. ExPASy Swiss-Prot
Match: GEML3_ARATH (Putative GEM-like protein 3 OS=Arabidopsis thaliana GN=At4g40100 PE=3 SV=2)

HSP 1 Score: 108.997 bits (271), Expect = 3.138e-23
Identity = 50/139 (35.97%), Postives = 83/139 (59.71%), Query Frame = 2
Query:  365 KLSLGAKIIQKGGRENIFKQIFGLTEGEEFLKASQCYLSTTRGPIAGLLFISNKKIAFCSERSISYSSSTGELIRTPYKVLIPIQKIKSIDESENVNKPEQKYVEIVTVDDFEFWFMGFLRYEKAYRNLQKAISMANEV 781
            +++   K++ +GG E IF+Q F     E+   +  CYLST+ GP+ G+L++S  K+A+CS+ S+               V+IP+ ++KS++ S +   P +KY+++++VDD EFWFMGFL YE A  +LQ  +     V
Sbjct:  113 RIAQSTKVLAEGGYEKIFRQTFETVPEEQLQNSFACYLSTSAGPVMGVLYVSTAKLAYCSDTSL---------------VVIPLHQLKSVNPSISTVNPAEKYIQVISVDDHEFWFMGFLNYEGAVTSLQDTLQAGASV 236          
The following BLAST results are available for this feature:
BLAST of CK933909 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
GEML8_ARATH6.067e-5156.40Putative GEM-like protein 8 OS=Arabidopsis thalian... [more]
GEML4_ARATH1.352e-5055.25GEM-like protein 4 OS=Arabidopsis thaliana GN=At5g... [more]
GEML6_ARATH2.549e-4956.47GEM-like protein 6 OS=Arabidopsis thaliana GN=At5g... [more]
GEML7_ARATH4.807e-4856.52GEM-like protein 7 OS=Arabidopsis thaliana GN=At5g... [more]
GEML2_ARATH5.705e-3345.03GEM-like protein 2 OS=Arabidopsis thaliana GN=At4g... [more]
GEML5_ARATH3.698e-3239.62GEM-like protein 5 OS=Arabidopsis thaliana GN=At5g... [more]
GEML1_ARATH1.007e-2936.08GEM-like protein 1 OS=Arabidopsis thaliana GN=FIP1... [more]
GEM_ARATH3.827e-2935.44GLABRA2 expression modulator OS=Arabidopsis thalia... [more]
GEML3_ARATH3.138e-2335.97Putative GEM-like protein 3 OS=Arabidopsis thalian... [more]
back to top
Properties
Property NameValue
Genbank descriptionCGF1004543_G06 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10003_IIF_G06 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK933909 ID=CK933909|Name=CK933909|organism=Citrus sinensis|type=EST|length=796bp
GGGGGATTGTGTAACAAGGCACAAGCAAAAAGCGTCTCTCAGGAATTTTT
ATTTTTATTTTTTTAATTATTAGTGTCTCAGGAATTAATTAGTGAAGATG
AAAGAAAAAGAAGCAGAATATTTTGAGATGGCGGTGTCATATGATACGAC
GCCAGAAAGATGTTCTTCTCAATCGCAACCATTCTGTTCGTTTCAAAGTC
CATCTTCTTCAGATGCCTCTCCCAGCTTCAGCTCTTTCAATGCAGATGAA
GAAGATACAGAAATGGGTCAGAGGAAATGTATTGAGAGCAAAGGTAGTAA
CTTCGCTTGCAGAATTCGAGATCACGTGAAAATGGGCCCAAAATTTTCTG
AAACAGTGAAAAGTAAGCTGAGCTTGGGAGCAAAAATTATTCAAAAAGGC
GGGAGGGAAAATATATTCAAGCAGATTTTTGGTTTGACAGAAGGGGAAGA
ATTCTTGAAGGCCTCACAGTGCTACTTATCAACGACGCGCGGTCCAATTG
CTGGACTTCTTTTTATTTCTAATAAGAAAATTGCTTTTTGCAGTGAAAGA
TCAATCTCTTACTCTTCGTCCACTGGAGAACTAATAAGAACACCATACAA
GGTGTTGATACCAATACAAAAGATCAAAAGTATCGACGAAAGTGAGAATG
TGAACAAGCCAGAGCAAAAGTACGTTGAAATAGTGACCGTAGACGATTTT
GAATTTTGGTTCATGGGATTTTTGCGCTATGAAAAAGCTTACAGAAATCT
TCAAAAGGCCATTTCTATGGCTAACGAAGTGTAAATNNNTAGGACC
back to top