CK933914

Overview
NameCK933914
Unique NameCK933914
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length484
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9581 contig Csv1_Contig9581:1..468. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK933914 vs. ExPASy Swiss-Prot
Match: PSA_HUMAN (Puromycin-sensitive aminopeptidase OS=Homo sapiens GN=NPEPPS PE=1 SV=2)

HSP 1 Score: 70.4774 bits (171), Expect = 4.499e-12
Identity = 47/123 (38.21%), Postives = 56/123 (45.53%), Query Frame = 2
Query:   77 MEEFKGQPRLPKFAVSKRYDIRLTPDLTSCKFGGSVAIDVDVVGDTKFIVLNAADLTINNRSVSFTNKVSSKALEPTKVELVEADEILVLEFAETLPTGMGVLAIGFEGVLNDKMKGFYRSSY 445
            M E +   RLP       Y + L PDL    F G +     V   T  IV+N AD+ I   S +       + +  T       DE + L F  TL TG G L I F G LNDKMKGFYRS Y
Sbjct:   45 MPEKRPFERLPADVSPINYSLCLKPDLLDFTFEGKLEAAAQVRQATNQIVMNCADIDIITASYA---PEGDEEIHATGFNYQNEDEKVTLSFPSTLQTGTGTLKIDFVGELNDKMKGFYRSKY 164          
BLAST of CK933914 vs. ExPASy Swiss-Prot
Match: PSA_MOUSE (Puromycin-sensitive aminopeptidase OS=Mus musculus GN=Npepps PE=1 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 5.876e-12
Identity = 47/123 (38.21%), Postives = 56/123 (45.53%), Query Frame = 2
Query:   77 MEEFKGQPRLPKFAVSKRYDIRLTPDLTSCKFGGSVAIDVDVVGDTKFIVLNAADLTINNRSVSFTNKVSSKALEPTKVELVEADEILVLEFAETLPTGMGVLAIGFEGVLNDKMKGFYRSSY 445
            M E +   RLP       Y + L PDL    F G +     V   T  IV+N AD+ I   S +       + +  T       DE + L F  TL TG G L I F G LNDKMKGFYRS Y
Sbjct:   46 MPEKRPFERLPAEVSPINYSLCLKPDLLDFTFEGKLEAAAQVRQATNQIVMNCADIDIITASYA---PEGDEEIHATGFNYQNEDEKVTLSFPSTLQTGTGTLKIDFVGELNDKMKGFYRSRY 165          
BLAST of CK933914 vs. ExPASy Swiss-Prot
Match: PSAL_HUMAN (Puromycin-sensitive aminopeptidase-like protein OS=Homo sapiens GN=NPEPPSL1 PE=2 SV=3)

HSP 1 Score: 67.0106 bits (162), Expect = 4.974e-11
Identity = 46/123 (37.40%), Postives = 55/123 (44.72%), Query Frame = 2
Query:   77 MEEFKGQPRLPKFAVSKRYDIRLTPDLTSCKFGGSVAIDVDVVGDTKFIVLNAADLTINNRSVSFTNKVSSKALEPTKVELVEADEILVLEFAETLPTGMGVLAIGFEGVLNDKMKGFYRSSY 445
            M E +   RLP         + L PDL    F G +     V   T  IV+N AD+ I   S +       + +  T       DE + L F  TL TG G L I F G LNDKMKGFYRS Y
Sbjct:   45 MPEKRPFERLPADVSPINCSLCLKPDLLDFTFEGKLEAAAQVRQATNQIVMNCADIDIITASYA---PEGDEEIHATGFNYQNEDEKVTLSFPSTLQTGTGTLKIDFVGELNDKMKGFYRSKY 164          
The following BLAST results are available for this feature:
BLAST of CK933914 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
PSA_HUMAN4.499e-1238.21Puromycin-sensitive aminopeptidase OS=Homo sapiens... [more]
PSA_MOUSE5.876e-1238.21Puromycin-sensitive aminopeptidase OS=Mus musculus... [more]
PSAL_HUMAN4.974e-1137.40Puromycin-sensitive aminopeptidase-like protein OS... [more]
back to top
Properties
Property NameValue
Genbank descriptionCGF1004543_F05 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10003_IIF_F05 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK933914 ID=CK933914|Name=CK933914|organism=Citrus sinensis|type=EST|length=484bp
GGGGACTCTTACTAGCACTTCTCAACTCTGAAAAATTATTCTAAAAAGTT
GGAAAAAAAAAAAAAGAGAGATAGAAATGGAGGAATTCAAAGGACAGCCT
CGTCTCCCAAAATTCGCAGTGTCGAAACGGTATGACATTCGCCTGACACC
TGACCTCACATCCTGCAAATTCGGCGGCTCAGTCGCCATCGACGTCGACG
TCGTCGGAGACACTAAATTCATCGTCCTCAATGCCGCCGACCTCACCATC
AACAACCGATCCGTTTCCTTCACCAACAAAGTCTCTTCTAAGGCGTTGGA
GCCTACGAAAGTGGAGTTGGTGGAAGCTGACGAGATTTTGGTACTGGAGT
TTGCGGAGACGCTTCCTACGGGGATGGGGGTTTTGGCTATTGGTTTTGAG
GGAGTGTTGAATGATAAAATGAAAGGCTTTTATAGAAGTTCTTATGAGCA
TAATGAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
back to top