CK933918

Overview
NameCK933918
Unique NameCK933918
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length855
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10040 contig Csv1_Contig10040:1..855. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK933918 vs. ExPASy Swiss-Prot
Match: CB11_SOLLC (Chlorophyll a-b binding protein 6A, chloroplastic OS=Solanum lycopersicum GN=CAB6A PE=2 SV=1)

HSP 1 Score: 423.705 bits (1088), Expect = 6.418e-118
Identity = 206/246 (83.74%), Postives = 219/246 (89.02%), Query Frame = 3
Query:   27 MASNTLMSCGIATTAFPSVLSSSKSKFFTAVSL-PAAANATSKYAMSADWMPGEPRPPYLDGSAPGDFGFDPLRLGEVPENLERYKESELIHCRWAMLAVPGILVPEALGLGNWVQAQEWAAVPGGQATYLGNPVPWGTLPTILVIEFLSIAFVEHQRSMEKDPEKKKYPGGAFDPLGFSKDPQKFEEYKVKEIKNGRLALLAFVGFCVQQSAYPGTGPLENLATHLADPWHNNIGDVIIPRGIVP 761
            MASNTLMSCGI     PS LSS+KSKF  A+ +   A N  S+++MSADWMPG+PRP YLDGSAPGDFGFD L LGEVP NLERYKESELIHCRWAMLAVPGI+VPEALGLGNWV+AQEWAA+PGGQATYLG PVPWGTLPTIL IEFL+IAFVEHQRSMEKD EKKKYPGGAFDPLG+SKDP KFEE KVKEIKNGRLALLA VGFCVQQSAY GTGPLENLATHLADPWHNNIGDVIIP+GI P
Sbjct:    1 MASNTLMSCGIPAVC-PSFLSSTKSKFAAAMPVYVGATNFMSRFSMSADWMPGQPRPSYLDGSAPGDFGFDSLGLGEVPANLERYKESELIHCRWAMLAVPGIIVPEALGLGNWVKAQEWAAIPGGQATYLGQPVPWGTLPTILAIEFLAIAFVEHQRSMEKDSEKKKYPGGAFDPLGYSKDPAKFEELKVKEIKNGRLALLAIVGFCVQQSAYLGTGPLENLATHLADPWHNNIGDVIIPKGIFP 245          
BLAST of CK933918 vs. ExPASy Swiss-Prot
Match: CB121_HORVU (Chlorophyll a-b binding protein 1B-21, chloroplastic OS=Hordeum vulgare GN=LHC Ib-21 PE=1 SV=1)

HSP 1 Score: 380.948 bits (977), Expect = 4.771e-105
Identity = 178/242 (73.55%), Postives = 202/242 (83.47%), Query Frame = 3
Query:   30 ASNTLMSCGIATTAFPSVLSSSKSKFFTAVSLPAAANATSKYAMSADWMPGEPRPPYLDGSAPGDFGFDPLRLGEVPENLERYKESELIHCRWAMLAVPGILVPEALGLGNWVQAQEWAAVPGGQATYLGNPVPWGTLPTILVIEFLSIAFVEHQRSMEKDPEKKKYPGGAFDPLGFSKDPQKFEEYKVKEIKNGRLALLAFVGFCVQQSAYPGTGPLENLATHLADPWHNNIGDVIIPRGI 755
            +S+ L SC  +    PS+L+ S     + +   A A  + +  MSA+W PG+PRP +LDGS+PGDFGFDPL L  VPEN ER+KESE+ HCRWAML VPG+LVPEALGLGNWV+AQEWAA+P GQATYLGNPVPWG LPTIL IEFL+IAF E QR+MEKDPEKKKYPGGAFDPLGFSKDP KFEE K+KEIKNGRLA+LAFVGFCVQQSAYPGTGPLENLATHLADPWHNNIGD++IPR I
Sbjct:    3 SSSGLRSC--SAVGVPSLLAPSSRSGRSGLPFCAYATTSGRVTMSAEWFPGQPRPAHLDGSSPGDFGFDPLGLATVPENFERFKESEIYHCRWAMLCVPGVLVPEALGLGNWVKAQEWAALPDGQATYLGNPVPWGNLPTILAIEFLAIAFAEQQRTMEKDPEKKKYPGGAFDPLGFSKDPAKFEELKLKEIKNGRLAMLAFVGFCVQQSAYPGTGPLENLATHLADPWHNNIGDIVIPRNI 242          
BLAST of CK933918 vs. ExPASy Swiss-Prot
Match: CB4A_ARATH (Chlorophyll a-b binding protein CP29.1, chloroplastic OS=Arabidopsis thaliana GN=LHCB4.1 PE=1 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 3.260e-37
Identity = 108/291 (37.11%), Postives = 148/291 (50.86%), Query Frame = 3
Query:   15 SSPKMASNTLMSCGIATTAFPSVLSSSKSKFFTAV----SLPAAANATSKYAMSAD---WMPGEPRPPYLDGSAPGDFGFDPLRLGEVPENLE-------------------------------------------RYKESELIHCRWAMLAVPGILVPEALGLGNWVQAQEWAAVPGGQATYLGNPVPWGTLPTILVIEFLSIAFVEHQRSMEKDPEKKKYPGGAF-DPLGFSKDPQKFEEYKVKEIKNGRLALLAFVGFCVQQSAYPGTGPLENLATHLADPWHNNIGD 734
            S+   A++++M   +A    P       S  FTAV       AA   ++K  ++ D   W PG   P +LDGS  GD+GFDP  LG+  E L+                                           R++E ELIH RWAMLA  G L  E L    W  A +   V G  ++YLG P+P+ ++ T++ IE L I ++E QR+ E D EK+ YPGG F DPLG + DP+K  + ++ EIK+ RLA++AF+GF VQ +A  G GPL N ATHL+DP H  I D
Sbjct:    5 SAAAAAASSIMGTRVAPGIHPG------SGRFTAVFGFGKKKAAPKKSAKKTVTTDRPLWYPGAISPDWLDGSLVGDYGFDPFGLGKPAEYLQFDIDSLDQNLAKNLAGDVIGTRTEAADAKSTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKVELVDG--SSYLGQPLPF-SISTLIWIEVLVIGYIEFQRNAELDSEKRLYPGGKFFDPLGLAADPEKTAQLQLAEIKHARLAMVAFLGFAVQAAA-TGKGPLNNWATHLSDPLHTTIID 285          
BLAST of CK933918 vs. ExPASy Swiss-Prot
Match: CB24_ARATH (Chlorophyll a-b binding protein 4, chloroplastic OS=Arabidopsis thaliana GN=CAB4 PE=1 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 7.263e-37
Identity = 95/243 (39.09%), Postives = 131/243 (53.91%), Query Frame = 3
Query:   66 TAFPSVLSSSKSKF-----FTAVSLPAAANATSKYAMSADWMPGEPRPPYLDGSAPGDFGFDPLRLGEVPENLERYKESELIHCRWAMLAVPGILVPEALGLGNWVQAQEWAAVPGGQATYLGNPVPWGTLPTILVIEFLSIAFVEHQR--------SMEKDPEKKK---------YPGGAFDPLGFSKDPQKFEEYKVKEIKNGRLALLAFVGFCVQQSAYPGTGPLENLATHLADPWHNNI 728
            T+ P  L+ S  +      FT++   A  ++    A   +W+PG   P YL GS  GD GFDPL L E PENL+ + ++EL++ RWAML V G+L+PE       +   EW     G+  Y      + +  T+ VIEF+   +VE +R        S+ +DP  K+         YPGG F+PL F+      +E K KE+ NGRLA+LAF+GF VQ +   G GP ENL  HL+DPWHN I
Sbjct:   17 TSKPRFLTGSSGRLNRDLSFTSIGSSAKTSSFKVEAKKGEWLPGLASPDYLTGSLAGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVFTKIGIINVPEW--YDAGKEQY------FASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPKGEVGYPGGIFNPLNFAPT----QEAKEKELANGRLAMLAFLGFVVQHNV-TGKGPFENLLQHLSDPWHNTI 246          
BLAST of CK933918 vs. ExPASy Swiss-Prot
Match: CB4B_ARATH (Chlorophyll a-b binding protein CP29.2, chloroplastic OS=Arabidopsis thaliana GN=LHCB4.2 PE=1 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 1.239e-36
Identity = 104/283 (36.75%), Postives = 139/283 (49.12%), Query Frame = 3
Query:   33 SNTLMSCGIATTAFPSVLSSSKSKFFTAVSLPAAANATSKYAMSAD-----WMPGEPRPPYLDGSAPGDFGFDPLRLGEVPE-------------------------------------------NLERYKESELIHCRWAMLAVPGILVPEALGLGNWVQAQEWAAVPGGQATYLGNPVPWGTLPTILVIEFLSIAFVEHQRSMEKDPEKKKYPGGAF-DPLGFSKDPQKFEEYKVKEIKNGRLALLAFVGFCVQQSAYPGTGPLENLATHLADPWHNNIGD 734
            S    +  I  T   S +SS+ S+F           A+ K A +       W PG   P YLDGS  GD+GFDP  LG+  E                                            L+R++E ELIH RWAMLA  G +  E L    W  A +   V G  ++YLG P+P+ ++ T++ IE L I ++E QR+ E D EK+ YPGG F DPLG + DP K  + ++ EIK+ RLA++ F+GF VQ +A  G GPL N ATHL+DP H  I D
Sbjct:    5 STAAAASSIMGTRVVSDISSNSSRFTARFGF-GTKKASPKKAKTVISDRPLWFPGAKSPEYLDGSLVGDYGFDPFGLGKPAEYLQFDLDSLDQNLAKNLYGEVIGTRTEAVDPKSTPFQPYSEVFGLQRFRECELIHGRWAMLATLGAITVEWLTGVTWQDAGKVELVDG--SSYLGQPLPF-SISTLIWIEVLVIGYIEFQRNAELDSEKRLYPGGKFFDPLGLASDPVKKAQLQLAEIKHARLAMVGFLGFAVQAAA-TGKGPLNNWATHLSDPLHTTIID 282          
BLAST of CK933918 vs. ExPASy Swiss-Prot
Match: CB12_SOLLC (Chlorophyll a-b binding protein 7, chloroplastic OS=Solanum lycopersicum GN=CAB7 PE=3 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 3.985e-35
Identity = 101/269 (37.55%), Postives = 133/269 (49.44%), Query Frame = 3
Query:   15 SSPKMASNTLMSCGIATTAFPSVLSSSKSKFFTAVSLPAAANATSKYAMSAD-----WMPGEPRPPYLDGSAPGDFGFDPLRLGEVPENLERYKESELIHCRWAMLAVPGILVPEALGLGNWVQAQEWAAVPGGQATYLGNPVPWGTLPTILVIEFLSIAFVEHQR--------SMEKDP---------EKKKYPGGA-FDPLGF-SKDPQKFEEYKVKEIKNGRLALLAFVGFCVQQSAYPGTGPLENLATHLADPWHNNIGDVIIPR 749
            SSP    N      I  T   S L   + +     + P A +AT+   ++AD     W PG   PP+LDGS PGDFGFDPL L   PE+L   +++EL+HCRWAML   GI +PE L     +    W     G+  Y  +        T+ ++E + I + E +R         +  DP             YPGG  FDPLG+ S  P K +E + KEIKNGRLA+LA +G   Q   Y GTGP++NL  HLADP H  I     P+
Sbjct:   16 SSPSSRRNG----SIVGTTKASFLGGRRLRVSKYSTTPTARSATT-VCVAADPDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLASDPESLRWNQQAELVHCRWAMLGAAGIFIPELLTKIGILNTPSW--YTAGEQEYFTDTT------TLFIVELVLIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPAKIKELRTKEIKNGRLAMLAVMGAWFQH-IYTGTGPIDNLFAHLADPGHATIFAAFSPK 270          
BLAST of CK933918 vs. ExPASy Swiss-Prot
Match: CB120_HORVU (Chlorophyll a-b binding protein 1B-20, chloroplastic (Fragment) OS=Hordeum vulgare GN=LHC Ib-20 PE=1 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 6.798e-35
Identity = 80/195 (41.03%), Postives = 110/195 (56.41%), Query Frame = 3
Query:  171 WMPGEPRPPYLDGSAPGDFGFDPLRLGEVPENLERYKESELIHCRWAMLAVPGILVPEALGLGNWVQAQEWAAVPGGQATYLGNPVPWGTLPTILVIEFLSIAFVEHQRSMEKDPEKKK---------YPGGAFDPLGFSKDPQKFEEYKVKEIKNGRLALLAFVGFCVQQSAYPGTGPLENLATHLADPWHNNI 728
            W+PG   P YLDGS  GD GFDPL L E PE+L  + ++++++ RWAML V G+L+PE L     + A EW  +PG +  +  +        +   +E      +++  S+ +DP  K          YPG  F+PL F+       E K KE+ NGRLA+LAF+GF VQ + + G GP ENL  HLADPWHN I
Sbjct:   36 WLPGLQSPAYLDGSLEGDNGFDPLALAEDPEDLRWFVQADVVNGRWAMLGVAGMLIPEVLTKAGLMNAPEWLRLPGKETYFASSSTALRVHMSSTYVEIRRWQDIKNPGSVNQDPIFKSYSLPPHECGYPGRVFNPLNFAP-----LENKEKELANGRLAMLAFLGFLVQHNVH-GKGPFENLQQHLADPWHNTI 224          
BLAST of CK933918 vs. ExPASy Swiss-Prot
Match: CB24_PEA (Chlorophyll a-b binding protein P4, chloroplastic OS=Pisum sativum GN=lhcA-P4 PE=1 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 8.878e-35
Identity = 92/236 (38.98%), Postives = 128/236 (54.24%), Query Frame = 3
Query:   84 LSSSKSKFFTAVSL-PAAANATSKYAMSA---DWMPGEPRPPYLDGSAPGDFGFDPLRLGEVPENLERYKESELIHCRWAMLAVPGILVPEALGLGNWVQAQEWAAVPGGQATYLGNPVPWGTLPTILVIEFLSIAFVEHQR--------SMEKDPEKKK---------YPGGAFDPLGFSKDPQKFEEYKVKEIKNGRLALLAFVGFCVQQSAYPGTGPLENLATHLADPWHNNI 728
            L  S  K    V+  P   + ++ + + A   +W+PG   P YL GS PGD GFDPL L E PENL  + ++EL++ RWAML V G+L+PE       +   +W A   G+  Y      + +  T+ VIEF+   +VE +R        S+ +DP  K+         YPGG F+PL F+       E K KEI NGRLA+LAF+GF +Q +   G GP +NL  H++DPWHN I
Sbjct:   23 LGGSSGKLNRGVAFRPVGCSPSASFKVEAKKGEWLPGLASPGYLTGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVFTSIGIINVPKWYA--AGKEEY------FASSSTLFVIEFILSHYVEIRRWQDIKNPGSVNQDPIFKQYSLPAGEVGYPGGIFNPLNFAPT----LEAKEKEIANGRLAMLAFLGFIIQHNV-TGKGPFDNLLQHISDPWHNTI 245          
BLAST of CK933918 vs. ExPASy Swiss-Prot
Match: CB26_ARATH (Chlorophyll a-b binding protein CP26, chloroplastic OS=Arabidopsis thaliana GN=LHCB5 PE=2 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 1.514e-34
Identity = 84/191 (43.98%), Postives = 111/191 (58.12%), Query Frame = 3
Query:  192 PPYLDGSAPGDFGFDPLRLGEVPENLERYKESELIHCRWAMLAVPGILVPEALGL--GNWVQAQEW-----AAVPGGQATYLGNPVPWGTLPTILVIEFLSIAFVEHQR-SMEKDPEKKKYPGGAFDPLGFSKDPQKFEEYKVKEIKNGRLALLAFVGFCVQQSAYPGTGPLENLATHLADPWHNNIGDVI 740
            P YL+G   GD+G+DP  LG+ PEN  +Y+  ELIH RWAML   G ++PEAL     N      W       + G    Y G  +P   L   +V E + +   E+ R +   D E K +PGG FDPLG +KDP++    KVKEIKNGRLA+ A +GF + Q+   G GP+ENLA HL+DP+ NN+  VI
Sbjct:   82 PEYLNGEVAGDYGYDPFGLGKKPENFAKYQAFELIHARWAMLGAAGFIIPEALNKYGANCGPEAVWFKTGALLLDGNTLNYFGKNIPI-NLVLAVVAEVVLLGGAEYYRITNGLDFEDKLHPGGPFDPLGLAKDPEQGALLKVKEIKNGRLAMFAMLGFFI-QAYVTGEGPVENLAKHLSDPFGNNLLTVI 270          
BLAST of CK933918 vs. ExPASy Swiss-Prot
Match: CB21_SINAL (Chlorophyll a-b binding protein 1, chloroplastic OS=Sinapis alba GN=CAB1 PE=3 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 4.406e-34
Identity = 90/195 (46.15%), Postives = 109/195 (55.90%), Query Frame = 3
Query:  180 GEPRPPYLDGSAPGDFGFDPLRLGEVPENLERYKESELIHCRWAMLAVPGILVPEAL-------GLGNWVQAQEWAAVPGGQATYLGNP--VPWGTLPTILVIEFLSIAFVEHQRSMEKDP----EKKKYPGGAFDPLGFSKDPQKFEEYKVKEIKNGRLALLAFVGFCVQQSAYPGTGPLENLATHLADPWHNN 725
            GEP P YL G  PGD+G+D   L   PE   R +E E+IHCRWAML   G + PE L       G   W +A       GG   YLGNP  V   ++  I   + + +  VE  R   + P    E   YPGG+FDPLG + DP+ F E KVKEIKNGRLA+ +  GF V Q+   G GPLENLA HLADP +NN
Sbjct:   63 GEP-PSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGG-LDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGEGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKEIKNGRLAMFSMFGFFV-QAIVTGKGPLENLADHLADPVNNN 254          
The following BLAST results are available for this feature:
BLAST of CK933918 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 85
Match NameE-valueIdentityDescription
CB11_SOLLC6.418e-11883.74Chlorophyll a-b binding protein 6A, chloroplastic ... [more]
CB121_HORVU4.771e-10573.55Chlorophyll a-b binding protein 1B-21, chloroplast... [more]
CB4A_ARATH3.260e-3737.11Chlorophyll a-b binding protein CP29.1, chloroplas... [more]
CB24_ARATH7.263e-3739.09Chlorophyll a-b binding protein 4, chloroplastic O... [more]
CB4B_ARATH1.239e-3636.75Chlorophyll a-b binding protein CP29.2, chloroplas... [more]
CB12_SOLLC3.985e-3537.55Chlorophyll a-b binding protein 7, chloroplastic O... [more]
CB120_HORVU6.798e-3541.03Chlorophyll a-b binding protein 1B-20, chloroplast... [more]
CB24_PEA8.878e-3538.98Chlorophyll a-b binding protein P4, chloroplastic ... [more]
CB26_ARATH1.514e-3443.98Chlorophyll a-b binding protein CP26, chloroplasti... [more]
CB21_SINAL4.406e-3446.15Chlorophyll a-b binding protein 1, chloroplastic O... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004543_F10 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10003_IIF_F10 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK933918 ID=CK933918|Name=CK933918|organism=Citrus sinensis|type=EST|length=855bp
GGGACCCCTCACACAGCTCTCCCAAAATGGCTTCCAACACTCTGATGAGC
TGCGGCATCGCCACCACCGCTTTCCCTTCGGTCCTCTCATCTTCTAAATC
CAAATTCTTTACTGCAGTTTCACTTCCAGCTGCCGCCAATGCAACCTCGA
AATACGCCATGTCTGCTGACTGGATGCCCGGCGAGCCCCGGCCGCCTTAT
CTTGATGGTTCAGCCCCAGGGGACTTTGGATTTGACCCACTTCGGCTTGG
CGAAGTTCCTGAGAACCTTGAGAGATACAAGGAGTCTGAACTCATTCACT
GCAGATGGGCTATGCTTGCTGTTCCAGGGATCTTGGTGCCAGAGGCATTG
GGATTGGGCAACTGGGTGCAGGCGCAAGAGTGGGCAGCAGTTCCTGGAGG
ACAAGCCACATACTTAGGCAACCCTGTTCCATGGGGCACTCTCCCCACAA
TTTTGGTGATTGAATTCCTTTCCATTGCCTTCGTTGAGCACCAACGCAGC
ATGGAGAAAGACCCCGAGAAGAAGAAGTACCCCGGTGGTGCTTTCGACCC
CTTGGGCTTCTCCAAGGACCCCCAGAAGTTCGAGGAATACAAAGTCAAGG
AGATAAAAAATGGGCGTTTGGCATTGTTGGCATTTGTGGGTTTCTGCGTG
CAACAATCAGCATATCCGGGCACAGGACCATTGGAGAACTTGGCAACTCA
CTTGGCTGATCCATGGCACAACAACATTGGGGACGTTATTATCCCCAGAG
GGATTGTGCCTTGAAGAACTGCATTGTTAAATTATCCAGTCCACTGTAAA
ATTCCCTGGTAAAAAGAGCTTTTAATGAAAAAAAAAAAAAAAAAAAAANA
AAAAA
back to top