CK934072

Overview
NameCK934072
Unique NameCK934072
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length544
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CK934072 vs. ExPASy Swiss-Prot
Match: METK2_CATRO (S-adenosylmethionine synthetase 2 OS=Catharanthus roseus GN=SAMS2 PE=1 SV=1)

HSP 1 Score: 227.639 bits (579), Expect = 2.926e-59
Identity = 112/115 (97.39%), Postives = 114/115 (99.13%), Query Frame = 1
Query:    1 TKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDTYRTGKIPDKEILRIVKENFDFRPGMIAINLDLKRGGNSRFLKTAAYGHFGREDPDFTWEVVKPLKYEK 345
            TKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDTY TGKIPDKEIL+IVKENFDFRPGMIAINLDLKRGGNSRFLKTAAYGHFGREDPDFTWEVVKPLK+EK
Sbjct:  276 TKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDTYGTGKIPDKEILKIVKENFDFRPGMIAINLDLKRGGNSRFLKTAAYGHFGREDPDFTWEVVKPLKFEK 390          
BLAST of CK934072 vs. ExPASy Swiss-Prot
Match: METK1_SOLTU (S-adenosylmethionine synthetase 1 OS=Solanum tuberosum GN=METK1 PE=2 SV=1)

HSP 1 Score: 227.639 bits (579), Expect = 2.926e-59
Identity = 110/118 (93.22%), Postives = 116/118 (98.31%), Query Frame = 1
Query:    1 TKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDTYRTGKIPDKEILRIVKENFDFRPGMIAINLDLKRGGNSRFLKTAAYGHFGREDPDFTWEVVKPLKYEKPQE 354
            TKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDTY TGKIPDKEIL+IVKENFDFRPGM++INLDLKRGGN RFLKTAAYGHFGR+DPDFTWEVVKPLK+EKPQ+
Sbjct:  276 TKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDTYGTGKIPDKEILKIVKENFDFRPGMMSINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQD 393          
BLAST of CK934072 vs. ExPASy Swiss-Prot
Match: METK1_SOLLC (S-adenosylmethionine synthetase 1 OS=Solanum lycopersicum GN=SAM1 PE=2 SV=1)

HSP 1 Score: 226.098 bits (575), Expect = 8.512e-59
Identity = 109/118 (92.37%), Postives = 116/118 (98.31%), Query Frame = 1
Query:    1 TKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDTYRTGKIPDKEILRIVKENFDFRPGMIAINLDLKRGGNSRFLKTAAYGHFGREDPDFTWEVVKPLKYEKPQE 354
            TKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDTY TGKIPD+EIL+IVKENFDFRPGM++INLDLKRGGN RFLKTAAYGHFGR+DPDFTWEVVKPLK+EKPQ+
Sbjct:  276 TKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDTYGTGKIPDREILKIVKENFDFRPGMMSINLDLKRGGNRRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQD 393          
BLAST of CK934072 vs. ExPASy Swiss-Prot
Match: METK4_VITVI (S-adenosylmethionine synthetase 4 OS=Vitis vinifera GN=METK4 PE=3 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 1.896e-58
Identity = 111/118 (94.07%), Postives = 114/118 (96.61%), Query Frame = 1
Query:    1 TKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDTYRTGKIPDKEILRIVKENFDFRPGMIAINLDLKRGGNSRFLKTAAYGHFGREDPDFTWEVVKPLKYEKPQE 354
            TKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDTY TGKIPDKEIL+IVKE+FDFRPGMIAINLDLKRGGN RFLKTAAYGHFGR+DPDFTWEVVKPLK EK QE
Sbjct:  276 TKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDTYATGKIPDKEILKIVKESFDFRPGMIAINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKAEKAQE 393          
BLAST of CK934072 vs. ExPASy Swiss-Prot
Match: METK_MEDTR (S-adenosylmethionine synthetase OS=Medicago truncatula GN=METK PE=3 SV=1)

HSP 1 Score: 224.557 bits (571), Expect = 2.477e-58
Identity = 108/117 (92.31%), Postives = 115/117 (98.29%), Query Frame = 1
Query:    1 TKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDTYRTGKIPDKEILRIVKENFDFRPGMIAINLDLKRGGNSRFLKTAAYGHFGREDPDFTWEVVKPLKYEKPQ 351
            TKVDRSGAY+VRQAAKSIVA+GLARRCIVQVSYAIGVPEPLSVFVD+Y TGKIPD+EIL+IVKENFDFRPGMI INLDLKRGGNSRFLKTAAYGHFGR+DPDFTWEVVKPLK+EKPQ
Sbjct:  277 TKVDRSGAYVVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDREILQIVKENFDFRPGMITINLDLKRGGNSRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQ 393          
BLAST of CK934072 vs. ExPASy Swiss-Prot
Match: METK2_POPTR (S-adenosylmethionine synthetase 2 OS=Populus trichocarpa GN=METK2 PE=2 SV=1)

HSP 1 Score: 223.402 bits (568), Expect = 5.517e-58
Identity = 110/118 (93.22%), Postives = 113/118 (95.76%), Query Frame = 1
Query:    1 TKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDTYRTGKIPDKEILRIVKENFDFRPGMIAINLDLKRGGNSRFLKTAAYGHFGREDPDFTWEVVKPLKYEKPQE 354
            TKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDTY TGKIPDKEIL IVKE FDFRPGMIAI+LDLKRGGN RFLKTAAYGHFGR+DPDFTWEVVKPLK EKPQ+
Sbjct:  276 TKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDTYGTGKIPDKEILNIVKEKFDFRPGMIAISLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKSEKPQQ 393          
BLAST of CK934072 vs. ExPASy Swiss-Prot
Match: METK2_ELAUM (S-adenosylmethionine synthetase 2 OS=Elaeagnus umbellata GN=SAMS2 PE=2 SV=1)

HSP 1 Score: 223.402 bits (568), Expect = 5.517e-58
Identity = 107/117 (91.45%), Postives = 114/117 (97.44%), Query Frame = 1
Query:    1 TKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDTYRTGKIPDKEILRIVKENFDFRPGMIAINLDLKRGGNSRFLKTAAYGHFGREDPDFTWEVVKPLKYEKPQ 351
            TKVDRSGAYIVRQAAKSIVA+GLARRCIVQVSYAIGVP+PLSVFVD+Y TGKIPDKEIL+IVKENFDFRPGMI INLDLKRGGN RFLKTAAYGHFGR+DPDFTWE+VKPLK+EKPQ
Sbjct:  276 TKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPDPLSVFVDSYGTGKIPDKEILKIVKENFDFRPGMITINLDLKRGGNDRFLKTAAYGHFGRDDPDFTWEIVKPLKWEKPQ 392          
BLAST of CK934072 vs. ExPASy Swiss-Prot
Match: METK_PHALU (S-adenosylmethionine synthetase OS=Phaseolus lunatus GN=SAMS PE=2 SV=1)

HSP 1 Score: 223.016 bits (567), Expect = 7.206e-58
Identity = 110/115 (95.65%), Postives = 113/115 (98.26%), Query Frame = 1
Query:    1 TKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDTYRTGKIPDKEILRIVKENFDFRPGMIAINLDLKRGGNSRFLKTAAYGHFGREDPDFTWEVVKPLKYEK 345
            TKVDRSGAYIVRQAAKSIVAS LARRCIVQVSYAIGVPEPLSVFVDTY TGKIPDKEIL+IVKENFDFRPGMI+INLDLKRGGNSRFLKTAAYGHFGREDPDFTWEVVKPLK+EK
Sbjct:  277 TKVDRSGAYIVRQAAKSIVASELARRCIVQVSYAIGVPEPLSVFVDTYGTGKIPDKEILKIVKENFDFRPGMISINLDLKRGGNSRFLKTAAYGHFGREDPDFTWEVVKPLKWEK 391          
BLAST of CK934072 vs. ExPASy Swiss-Prot
Match: METK3_ACTCH (S-adenosylmethionine synthetase 3 (Fragment) OS=Actinidia chinensis GN=SAM3 PE=2 SV=1)

HSP 1 Score: 223.016 bits (567), Expect = 7.206e-58
Identity = 109/118 (92.37%), Postives = 115/118 (97.46%), Query Frame = 1
Query:    1 TKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDTYRTGKIPDKEILRIVKENFDFRPGMIAINLDLKRGGNSRFLKTAAYGHFGREDPDFTWEVVKPLKYEKPQE 354
            TKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDTY TGKIPDKEIL+IVKE+FDFRPGMIAI+LDLKRGGN RFLKTAAYGHFGR+D DFTWEVVKPLK+EKPQ+
Sbjct:  243 TKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDTYGTGKIPDKEILKIVKESFDFRPGMIAIHLDLKRGGNGRFLKTAAYGHFGRDDADFTWEVVKPLKWEKPQD 360          
BLAST of CK934072 vs. ExPASy Swiss-Prot
Match: METK2_VITVI (S-adenosylmethionine synthetase 2 OS=Vitis vinifera GN=METK2 PE=3 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 9.411e-58
Identity = 108/117 (92.31%), Postives = 114/117 (97.44%), Query Frame = 1
Query:    1 TKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDTYRTGKIPDKEILRIVKENFDFRPGMIAINLDLKRGGNSRFLKTAAYGHFGREDPDFTWEVVKPLKYEKPQ 351
            TKVDRSGAYIVRQAAKSIVA+GLARRCIVQVSYAIGVPEPLSVFVDTY TGKIPD+EIL+IVKENFDFRPGMI+INLDLKRGGN RFLKTAAYGHFGR+DPDFTWEVVKPLK+EK Q
Sbjct:  276 TKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDTYGTGKIPDREILKIVKENFDFRPGMISINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKTQ 392          
The following BLAST results are available for this feature:
BLAST of CK934072 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK2_CATRO2.926e-5997.39S-adenosylmethionine synthetase 2 OS=Catharanthus ... [more]
METK1_SOLTU2.926e-5993.22S-adenosylmethionine synthetase 1 OS=Solanum tuber... [more]
METK1_SOLLC8.512e-5992.37S-adenosylmethionine synthetase 1 OS=Solanum lycop... [more]
METK4_VITVI1.896e-5894.07S-adenosylmethionine synthetase 4 OS=Vitis vinifer... [more]
METK_MEDTR2.477e-5892.31S-adenosylmethionine synthetase OS=Medicago trunca... [more]
METK2_POPTR5.517e-5893.22S-adenosylmethionine synthetase 2 OS=Populus trich... [more]
METK2_ELAUM5.517e-5891.45S-adenosylmethionine synthetase 2 OS=Elaeagnus umb... [more]
METK_PHALU7.206e-5895.65S-adenosylmethionine synthetase OS=Phaseolus lunat... [more]
METK3_ACTCH7.206e-5892.37S-adenosylmethionine synthetase 3 (Fragment) OS=Ac... [more]
METK2_VITVI9.411e-5892.31S-adenosylmethionine synthetase 2 OS=Vitis vinifer... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004541_G09 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10001_IIIF_G09 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK934072 ID=CK934072|Name=CK934072|organism=Citrus sinensis|type=EST|length=544bp
ACCAAGGTTGATAGAAGTGGTGCTTACATTGTGAGGCAGGCAGCAAAGAG
CATCGTTGCCAGTGGCCTTGCTCGCCGCTGCATTGTGCAGGTTTCTTATG
CTATTGGTGTCCCAGAGCCCCTTTCAGTGTTTGTTGACACTTATCGAACT
GGAAAGATTCCGGACAAGGAGATCCTGAGGATTGTGAAGGAGAACTTTGA
TTTCAGGCCTGGAATGATTGCCATTAACTTGGATCTCAAGAGGGGAGGAA
ATAGCAGGTTTTTGAAGACTGCTGCATATGGGCATTTTGGAAGGGAGGAT
CCTGACTTCACATGGGAGGTGGTGAAGCCCCTCAAGTATGAGAAACCCCA
AGAGTAGTATTTAAGTATGCAGTTTCATTCTTTGTTTGAACTTAATAATT
TACTTGTTCTTTCGTCTGCCTGTCAGATTCTGTCTTTTTTCTCTCTTGGT
CTTGGCCTTTTTTTTTATAAATAAATTTGTATTATCTTTGCCATAATAGA
AAGATATATGTGGCCAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
back to top