CK934082

Overview
NameCK934082
Unique NameCK934082
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length769
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CK934082_ssr47 microsatellite CK934082_ssr47:47..68. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of CK934082 vs. ExPASy Swiss-Prot
Match: AL2B7_ARATH (Aldehyde dehydrogenase family 2 member B7, mitochondrial OS=Arabidopsis thaliana GN=ALDH2B7 PE=2 SV=2)

HSP 1 Score: 198.749 bits (504), Expect = 2.476e-59
Identity = 90/123 (73.17%), Postives = 105/123 (85.37%), Query Frame = 2
Query:  401 GKTFPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEGPWPKMTPYERSRIMLRAADLIEKNMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVPGDGXXHIQTLHE 769
            GKTFP  DPR  EVIA V+EGDAED++RAVA ARKAFDEGPWPKMT YERS+I+ R ADLIEK+ +E+AALETW+NGKPY QS + EVPM+ R+  YYAGWADKIHG+T+PGDG  H+QTLHE
Sbjct:   68 GKTFPTLDPRNGEVIAQVSEGDAEDVNRAVAAARKAFDEGPWPKMTAYERSKILFRFADLIEKHNDEIAALETWDNGKPYEQSAQIEVPMLARVFRYYAGWADKIHGMTMPGDGPHHVQTLHE 190          

HSP 2 Score: 50.0618 bits (118), Expect = 2.476e-59
Identity = 31/68 (45.59%), Postives = 40/68 (58.82%), Query Frame = 3
Query:  120 ISTLLSRSFPSAXXXXXXXXXXXXXXARGISRFST-AAVVEEPIIPPVQISYTKNLINGQFVDAASGK 320
            +S+LLSRSF S+               RG  R+S  AA VE  I PPV++ +T+ LI G+FVDA SGK
Sbjct:    6 VSSLLSRSFMSSSRSIFSLRGMN----RGAQRYSNLAAAVENTITPPVKVEHTQLLIGGRFVDAVSGK 69          
BLAST of CK934082 vs. ExPASy Swiss-Prot
Match: AL2B4_ARATH (Aldehyde dehydrogenase family 2 member B4, mitochondrial OS=Arabidopsis thaliana GN=ALDH2B4 PE=1 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 9.327e-59
Identity = 91/125 (72.80%), Postives = 104/125 (83.20%), Query Frame = 2
Query:  395 ALGKTFPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEGPWPKMTPYERSRIMLRAADLIEKNMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVPGDGXXHIQTLHE 769
            A GKTFP  DPRT EVIA+VAEGDAEDI+RAV  AR AFDEGPWPKM+ YERSR++LR ADL+EK+ EELA+LETW+NGKPY QSL +E+PM  RL  YYAGWADKIHGLT+P DG   + TLHE
Sbjct:   70 ASGKTFPTLDPRTGEVIAHVAEGDAEDINRAVKAARTAFDEGPWPKMSAYERSRVLLRFADLVEKHSEELASLETWDNGKPYQQSLTAEIPMFARLFRYYAGWADKIHGLTIPADGNYQVHTLHE 194          

HSP 2 Score: 49.6766 bits (117), Expect = 9.327e-59
Identity = 29/68 (42.65%), Postives = 40/68 (58.82%), Query Frame = 3
Query:  120 ISTLLSRSFPSAXXXXXXXXXXXXXXARGISRFSTAAVVEEPII-PPVQISYTKNLINGQFVDAASGK 320
            +S+LLSRSF ++                 + RF T++   E II P VQ+S+T+ LING FVD+ASGK
Sbjct:    6 VSSLLSRSFSASSPLLFRSQGRNCYNGGILRRFGTSSAAAEEIINPSVQVSHTQLLINGNFVDSASGK 73          
BLAST of CK934082 vs. ExPASy Swiss-Prot
Match: ALDH2_PONAB (Aldehyde dehydrogenase, mitochondrial OS=Pongo abelii GN=ALDH2 PE=2 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 2.519e-30
Identity = 68/123 (55.28%), Postives = 82/123 (66.67%), Query Frame = 2
Query:  404 KTFPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEG-PWPKMTPYERSRIMLRAADLIEKNMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVPGDGXXHIQTLHE 769
            KTFP  +P T EVI  VAEGD ED+D+AV  AR AF  G PW +M    R R++ R ADLIE++   LAALET +NGKPYV S   ++ MV++ L YYAGWADK HG T+P DG     T HE
Sbjct:   52 KTFPTVNPSTGEVICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHE 174          
BLAST of CK934082 vs. ExPASy Swiss-Prot
Match: ALDH2_HUMAN (Aldehyde dehydrogenase, mitochondrial OS=Homo sapiens GN=ALDH2 PE=1 SV=2)

HSP 1 Score: 132.494 bits (332), Expect = 2.519e-30
Identity = 68/123 (55.28%), Postives = 82/123 (66.67%), Query Frame = 2
Query:  404 KTFPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEG-PWPKMTPYERSRIMLRAADLIEKNMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVPGDGXXHIQTLHE 769
            KTFP  +P T EVI  VAEGD ED+D+AV  AR AF  G PW +M    R R++ R ADLIE++   LAALET +NGKPYV S   ++ MV++ L YYAGWADK HG T+P DG     T HE
Sbjct:   52 KTFPTVNPSTGEVICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHE 174          
BLAST of CK934082 vs. ExPASy Swiss-Prot
Match: AL2C4_ARATH (Aldehyde dehydrogenase family 2 member C4 OS=Arabidopsis thaliana GN=ALDH2C4 PE=1 SV=2)

HSP 1 Score: 117.857 bits (294), Expect = 3.044e-30
Identity = 58/112 (51.79%), Postives = 76/112 (67.86%), Query Frame = 2
Query:  395 ALGKTFPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEGPWPKMTPYERSRIMLRAADLIEKNMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTV 730
            A GKTF   DPR  EVIA +AEGD ED+D AV  AR AFD GPWP+MT +ER++++ + ADLIE+N+EELA L+  + GK +     +++P       Y AG ADKIHG T+
Sbjct:   32 ASGKTFETIDPRNGEVIATIAEGDKEDVDLAVNAARYAFDHGPWPRMTGFERAKLINKFADLIEENIEELAKLDAVDGGKLFQLGKYADIPATAGHFRYNAGAADKIHGETL 143          

HSP 2 Score: 33.4982 bits (75), Expect = 3.044e-30
Identity = 14/20 (70.00%), Postives = 17/20 (85.00%), Query Frame = 3
Query:  261 QISYTKNLINGQFVDAASGK 320
            +I +TK  INGQF+DAASGK
Sbjct:   16 EIKFTKLFINGQFIDAASGK 35          
BLAST of CK934082 vs. ExPASy Swiss-Prot
Match: ALDH2_MOUSE (Aldehyde dehydrogenase, mitochondrial OS=Mus musculus GN=Aldh2 PE=1 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 3.290e-30
Identity = 67/123 (54.47%), Postives = 83/123 (67.48%), Query Frame = 2
Query:  404 KTFPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEG-PWPKMTPYERSRIMLRAADLIEKNMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVPGDGXXHIQTLHE 769
            KTFP  +P T EVI  VAEG+ ED+D+AV  AR AF  G PW +M   +R R++ R ADLIE++   LAALET +NGKPYV S   ++ MV++ L YYAGWADK HG T+P DG     T HE
Sbjct:   54 KTFPTVNPSTGEVICQVAEGNKEDVDKAVKAARAAFQLGSPWRRMDASDRGRLLYRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHE 176          
BLAST of CK934082 vs. ExPASy Swiss-Prot
Match: ALDH2_HORSE (Aldehyde dehydrogenase, mitochondrial OS=Equus caballus GN=ALDH2 PE=1 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 3.290e-30
Identity = 68/123 (55.28%), Postives = 82/123 (66.67%), Query Frame = 2
Query:  404 KTFPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEG-PWPKMTPYERSRIMLRAADLIEKNMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVPGDGXXHIQTLHE 769
            KTFP  +P T EVI  VA GD ED+DRAV  AR AF  G PW +M   +R R++ R ADLIE++   LAALET +NGKPYV S   ++ MV++ L YYAGWADK HG T+P DG     T HE
Sbjct:   35 KTFPTVNPSTGEVICQVAAGDKEDVDRAVKAARAAFQLGSPWRRMDASDRGRLLNRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHE 157          
BLAST of CK934082 vs. ExPASy Swiss-Prot
Match: ALDH2_BOVIN (Aldehyde dehydrogenase, mitochondrial OS=Bos taurus GN=ALDH2 PE=1 SV=2)

HSP 1 Score: 132.109 bits (331), Expect = 3.290e-30
Identity = 67/123 (54.47%), Postives = 83/123 (67.48%), Query Frame = 2
Query:  404 KTFPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEG-PWPKMTPYERSRIMLRAADLIEKNMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVPGDGXXHIQTLHE 769
            KTFP  +P T +VI +VAEGD  D+DRAV  AR AF  G PW +M   ER R++ R ADLIE++   LAALET +NGKPY+ S   ++ MV++ L YYAGWADK HG T+P DG     T HE
Sbjct:   55 KTFPTVNPSTGDVICHVAEGDKADVDRAVKAARAAFQLGSPWRRMDASERGRLLNRLADLIERDRTYLAALETLDNGKPYIISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDYFSYTRHE 177          
BLAST of CK934082 vs. ExPASy Swiss-Prot
Match: ALDH2_PIG (Aldehyde dehydrogenase, mitochondrial OS=Sus scrofa GN=ALDH2 PE=2 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 4.297e-30
Identity = 67/123 (54.47%), Postives = 84/123 (68.29%), Query Frame = 2
Query:  404 KTFPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEG-PWPKMTPYERSRIMLRAADLIEKNMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVPGDGXXHIQTLHE 769
            KTFP  +P T +VI +VAEGD ED+DRAV  AR AF  G PW ++   +R R++ R ADLIE++   LAALET +NGKPYV S   ++ MV++ L YYAGWADK HG T+P DG     T HE
Sbjct:   56 KTFPTVNPSTGDVICHVAEGDKEDVDRAVEAARAAFQLGSPWRRLDASDRGRLLNRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTLPIDGDYFSYTRHE 178          
BLAST of CK934082 vs. ExPASy Swiss-Prot
Match: ALDH2_MESAU (Aldehyde dehydrogenase, mitochondrial OS=Mesocricetus auratus GN=ALDH2 PE=1 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 7.330e-30
Identity = 67/123 (54.47%), Postives = 82/123 (66.67%), Query Frame = 2
Query:  404 KTFPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEG-PWPKMTPYERSRIMLRAADLIEKNMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVPGDGXXHIQTLHE 769
            KTFP  +P T EVI  VAEG  ED+D+AV  AR AF  G PW +M   +R R++ R ADLIE++   LAALET +NGKPYV S   ++ MV++ L YYAGWADK HG T+P DG     T HE
Sbjct:   35 KTFPTVNPSTGEVICQVAEGSKEDVDKAVKAARAAFQLGSPWRRMDASDRGRLLNRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHE 157          
The following BLAST results are available for this feature:
BLAST of CK934082 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 207
Match NameE-valueIdentityDescription
AL2B7_ARATH2.476e-5973.17Aldehyde dehydrogenase family 2 member B7, mitocho... [more]
AL2B4_ARATH9.327e-5972.80Aldehyde dehydrogenase family 2 member B4, mitocho... [more]
ALDH2_PONAB2.519e-3055.28Aldehyde dehydrogenase, mitochondrial OS=Pongo abe... [more]
ALDH2_HUMAN2.519e-3055.28Aldehyde dehydrogenase, mitochondrial OS=Homo sapi... [more]
AL2C4_ARATH3.044e-3051.79Aldehyde dehydrogenase family 2 member C4 OS=Arabi... [more]
ALDH2_MOUSE3.290e-3054.47Aldehyde dehydrogenase, mitochondrial OS=Mus muscu... [more]
ALDH2_HORSE3.290e-3055.28Aldehyde dehydrogenase, mitochondrial OS=Equus cab... [more]
ALDH2_BOVIN3.290e-3054.47Aldehyde dehydrogenase, mitochondrial OS=Bos tauru... [more]
ALDH2_PIG4.297e-3054.47Aldehyde dehydrogenase, mitochondrial OS=Sus scrof... [more]
ALDH2_MESAU7.330e-3054.47Aldehyde dehydrogenase, mitochondrial OS=Mesocrice... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004541_F12 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10001_IIIF_F12 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK934082 ID=CK934082|Name=CK934082|organism=Citrus sinensis|type=EST|length=769bp
GGGGATGCATGCAGTTGCAAGCTTAACTCGCTAGGACAAAAGTTGCAGAG
AGAGAGAGAGAGAGAGAGAAGAGTTGAATAGGTCGCTTCTTCGCTTTGGC
TATGGCAGCTGCTCGCAGAATCTCCACCTTGCTGTCTCGTTCTTTCCCTT
CTGCTTCTCCTTCTCTGCTTCGCTCTCTTGGTAGGGAGTCTAGCAGGGCA
AGAGGCATCAGCAGGTTTAGCACAGCTGCTGTTGTTGAAGAGCCAATCAT
TCCACCTGTTCAAATTAGTTACACTAAGAATTTAATAAATGGCCAATTTG
TAGACGCAGCATCAGGTAAGATGATTGTTTCCTGATATTTTGGAGCTCAT
TGTTTCTGTTGCTGATAATGAGCCCAATGTTGGAAACTTGTCTGGCCTTA
GGCAAAACATTTCCGGTCTACGACCCTCGTACTGCTGAAGTGATTGCTAA
TGTTGCTGAAGGAGATGCGGAAGATATTGACCGTGCAGTTGCTACTGCTC
GCAAGGCATTTGATGAGGGACCTTGGCCAAAGATGACCCCTTATGAGAGG
TCAAGGATTATGTTGCGGGCTGCTGACTTGATTGAGAAAAACATGGAGGA
GCTGGCAGCTTTGGAGACATGGAACAATGGAAAGCCCTATGTACAATCTC
TCAAATCTGAAGTACCAATGGTGGTTCGCCTGTTGCACTATTATGCTGGA
TGGGCTGATAAAATCCACGGACTAACTGTCCCTGGTGATGGAANNNACCA
TATTCAAACTTTACATGAA
back to top