CK934223

Overview
NameCK934223
Unique NameCK934223
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length838
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CK934223_ssr559 microsatellite CK934223_ssr559:559..570. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig9760 contig Csv1_Contig9760:1..838. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK934223 vs. ExPASy Swiss-Prot
Match: H1_SOLPN (Histone H1 OS=Solanum pennellii PE=2 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 3.295e-26
Identity = 57/74 (77.03%), Postives = 65/74 (87.84%), Query Frame = 3
Query:  237 SKTPSHPPYFQMITEALTALQDKSGSSPYAIAKYMEEKHKDELPANFRKILAVQLKHFAAKGNLIKIRASYKLS 458
            +K  +HPPYFQMI EAL AL +K GSSPYA+AKYME+KHKDELPANFRKIL +QLK+ AAKG LIKI+ASYKLS
Sbjct:   44 AKAVTHPPYFQMIKEALLALNEKGGSSPYAVAKYMEDKHKDELPANFRKILGLQLKNSAAKGKLIKIKASYKLS 117          
BLAST of CK934223 vs. ExPASy Swiss-Prot
Match: H1_MAIZE (Histone H1 OS=Zea mays PE=2 SV=2)

HSP 1 Score: 91.2781 bits (225), Expect = 7.357e-18
Identity = 41/72 (56.94%), Postives = 59/72 (81.94%), Query Frame = 3
Query:  243 TPSHPPYFQMITEALTALQDKSGSSPYAIAKYMEEKHKDELPANFRKILAVQLKHFAAKGNLIKIRASYKLS 458
            +P+H PY +M++EA+T+L++++GSS YAIAK++E+KHK +LP NFRK+L VQLK   A G L K++ SYKLS
Sbjct:   47 SPTHLPYAEMVSEAITSLKERTGSSSYAIAKFVEDKHKAKLPPNFRKLLNVQLKKLVAGGKLTKVKNSYKLS 118          
BLAST of CK934223 vs. ExPASy Swiss-Prot
Match: H1_WHEAT (Histone H1 OS=Triticum aestivum PE=2 SV=2)

HSP 1 Score: 89.7373 bits (221), Expect = 2.141e-17
Identity = 40/72 (55.56%), Postives = 55/72 (76.39%), Query Frame = 3
Query:  243 TPSHPPYFQMITEALTALQDKSGSSPYAIAKYMEEKHKDELPANFRKILAVQLKHFAAKGNLIKIRASYKLS 458
            TP+HP Y +M++EA+ AL+++SGSS  AI K++E+KHK  LPANFRKIL  Q+K   A G L K++ SYKL+
Sbjct:   52 TPAHPSYAEMVSEAIAALKERSGSSTIAIGKFIEDKHKAHLPANFRKILLTQIKKLVAAGKLTKVKGSYKLA 123          
BLAST of CK934223 vs. ExPASy Swiss-Prot
Match: H1_SOLLC (Histone H1 OS=Solanum lycopersicum PE=3 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 2.367e-16
Identity = 39/74 (52.70%), Postives = 57/74 (77.03%), Query Frame = 3
Query:  234 QSKTPSHPPYFQMITEALTALQDKSGSSPYAIAKYMEEKHKDELPANFRKILAVQLKHFAAKGNLIKIRASYKL 455
            +S TP+HPPYF+MI +A+  L++++GSS +AI K++EEK K  LP+NF+K+L  QLK F A   L+K++ SYKL
Sbjct:   50 RSATPTHPPYFEMIKDAIVTLKERTGSSQHAITKFIEEKQK-SLPSNFKKLLLTQLKKFVASEKLVKVKNSYKL 122          
BLAST of CK934223 vs. ExPASy Swiss-Prot
Match: H1_EUPES (Histone H1 OS=Euphorbia esula PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 7.614e-15
Identity = 36/71 (50.70%), Postives = 56/71 (78.87%), Query Frame = 3
Query:  243 TPSHPPYFQMITEALTALQDKSGSSPYAIAKYMEEKHKDELPANFRKILAVQLKHFAAKGNLIKIRASYKL 455
            T SHP +F+MI++A++ L++++GSS YAI K++E+KHK +LP+NFRK+L   LK   A G L+K++ S+KL
Sbjct:   48 TSSHPSFFEMISDAISTLKERTGSSQYAINKFVEDKHK-QLPSNFRKLLLFHLKKLVASGKLVKVKNSFKL 117          
BLAST of CK934223 vs. ExPASy Swiss-Prot
Match: H1_PEA (Histone H1 OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 2.215e-14
Identity = 39/70 (55.71%), Postives = 54/70 (77.14%), Query Frame = 3
Query:  249 SHPPYFQMITEALTALQDKSGSSPYAIAKYMEEKHKDELPANFRKILAVQLKHFAAKGNLIKIRASYKLS 458
            SHP Y +MI +A+ +L++K+GSS YAIAK++EEK K +LPANF+K+L   LK   A G LIK++ S+KLS
Sbjct:   61 SHPTYEEMIKDAIVSLKEKNGSSQYAIAKFIEEKQK-QLPANFKKLLLQNLKKNVASGKLIKVKGSFKLS 129          
BLAST of CK934223 vs. ExPASy Swiss-Prot
Match: H12_ARATH (Histone H1.2 OS=Arabidopsis thaliana GN=At2g30620 PE=1 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.875e-13
Identity = 36/71 (50.70%), Postives = 51/71 (71.83%), Query Frame = 3
Query:  243 TPSHPPYFQMITEALTALQDKSGSSPYAIAKYMEEKHKDELPANFRKILAVQLKHFAAKGNLIKIRASYKL 455
            T SHP Y +MI +A+  L++++GSS YAI K++EEKHK  LP  FRK+L V LK   A   L+K++AS+K+
Sbjct:   59 TSSHPTYEEMIKDAIVTLKERTGSSQYAIQKFIEEKHK-SLPPTFRKLLLVNLKRLVASEKLVKVKASFKI 128          
BLAST of CK934223 vs. ExPASy Swiss-Prot
Match: H11_ARATH (Histone H1.1 OS=Arabidopsis thaliana GN=At1g06760 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.875e-13
Identity = 36/69 (52.17%), Postives = 51/69 (73.91%), Query Frame = 3
Query:  249 SHPPYFQMITEALTALQDKSGSSPYAIAKYMEEKHKDELPANFRKILAVQLKHFAAKGNLIKIRASYKL 455
            SHP Y +MI +A+  L++++GSS YAI K++EEK K ELP  FRK+L + LK   A G L+K++AS+KL
Sbjct:   61 SHPTYEEMIKDAIVTLKERTGSSQYAIQKFIEEKRK-ELPPTFRKLLLLNLKRLVASGKLVKVKASFKL 128          
BLAST of CK934223 vs. ExPASy Swiss-Prot
Match: H12_VOLCA (Histone H1-II OS=Volvox carteri GN=H1-II PE=2 SV=3)

HSP 1 Score: 68.5514 bits (166), Expect = 5.107e-11
Identity = 33/72 (45.83%), Postives = 50/72 (69.44%), Query Frame = 3
Query:  246 PSHPPYFQMITEALTALQDKSGSSPYAIAKYMEEKH-KDELPANFRKILAVQLKHFAAKGNLIKIRASYKLS 458
            P+HPPY QM+T+A+ +L+++ GSS  A+ K++E K+ KD     F K L++ LK F   G L+K++ SYKLS
Sbjct:   23 PTHPPYIQMVTDAILSLKERDGSSLPALKKFIEAKYGKDIHDKKFPKTLSLALKTFVKNGKLVKVKNSYKLS 94          
The following BLAST results are available for this feature:
BLAST of CK934223 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
H1_SOLPN3.295e-2677.03Histone H1 OS=Solanum pennellii PE=2 SV=1[more]
H1_MAIZE7.357e-1856.94Histone H1 OS=Zea mays PE=2 SV=2[more]
H1_WHEAT2.141e-1755.56Histone H1 OS=Triticum aestivum PE=2 SV=2[more]
H1_SOLLC2.367e-1652.70Histone H1 OS=Solanum lycopersicum PE=3 SV=1[more]
H1_EUPES7.614e-1550.70Histone H1 OS=Euphorbia esula PE=2 SV=1[more]
H1_PEA2.215e-1455.71Histone H1 OS=Pisum sativum PE=2 SV=1[more]
H12_ARATH1.875e-1350.70Histone H1.2 OS=Arabidopsis thaliana GN=At2g30620 ... [more]
H11_ARATH1.875e-1352.17Histone H1.1 OS=Arabidopsis thaliana GN=At1g06760 ... [more]
H12_VOLCA5.107e-1145.83Histone H1-II OS=Volvox carteri GN=H1-II PE=2 SV=3[more]
back to top
Properties
Property NameValue
Genbank descriptionCGF1004261_G10 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10004_IVF_G10 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK934223 ID=CK934223|Name=CK934223|organism=Citrus sinensis|type=EST|length=838bp
GGGGGAATAAATAAACAATCAAGGCTGTAATTCAAGGCTTTAGTTTTCTT
CTAGTAATTCTGCGAGATCGTTTTGAGCCAATTCGTTAGTTGCGAAAGTA
GATGGCCACAGAAGGTGAAGCTGTGACGGAGCAGCAGCCGGCTGCGGAGG
AGCCGGAAAAGGTCGTCACTGAGAAGAAGGCCAAGGCTGCTAAGGAGAAG
AAGCCCAAGGCTCCTAAAGAGAAGAAGCCAAAGCAGTCCAAAACCCCCTC
TCATCCTCCTTATTTTCAGATGATAACGGAGGCACTGACGGCGCTGCAAG
ATAAGAGCGGTTCAAGCCCATACGCAATAGCCAAGTACATGGAAGAGAAG
CACAAGGATGAGCTCCCAGCGAATTTCAGGAAAATATTGGCAGTGCAGCT
GAAGCACTTTGCCGCGAAAGGAAATCTCATCAAGATCAGGGCCTCTTACA
AGCTCTCTGAAGCGGCAGCTGGCAAAACCAAAAAAGAGATCAAGACCAAG
GCCAAGGCCCCAAGGAAAACAAGGTCCGTAACTGCTGCAGCTAAAATCAA
AGCAGAGTCCGCCGCCGCCGCTCCTCCTCCGCCTAAGAAGGCAAAGAAAT
CAGCTGCTGCCAAACCAAAGCAGCCCAAATCCATCAAGTCCCCTGCTGCT
AAGAAAGCCAAGAAAGCTGCTGCCCAGTAGTAATATGTATGATATAATAC
TAGTAAAGTACAAACTAGTTTCAACTTTCTTGTCTGTTAAGAAGTATCAT
GTACATGTCAACTCCCGGTATGATCGTGTTTTGCATAAATGAATGTAATG
ATCTCCCGGAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
back to top