CK934228

Overview
NameCK934228
Unique NameCK934228
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length879
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig11916 contig Csv1_Contig11916:1..874. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK934228 vs. ExPASy Swiss-Prot
Match: GSTF3_ARATH (Glutathione S-transferase ERD13 OS=Arabidopsis thaliana GN=ERD13 PE=1 SV=3)

HSP 1 Score: 291.197 bits (744), Expect = 5.209e-78
Identity = 133/207 (64.25%), Postives = 171/207 (82.61%), Query Frame = 2
Query:   71 MVVKVYGPAYASPKRVIVCLIEKQIEFETAPVDLIKGEHRNPEYLKLQPFGALPVIQDGDFTLYESRAIIRYYAEKYRSQGTELLGKTIEERGLVEQWLEVEAHNYHPPIYEMTVQLLFASKLGLSVDEKLVKKSEEKLGKVLDVYEERLSKSNYLAGDFFSLADLSHLPFTQYLVGPMEKEYMIRDRKHVSAWWDDISNRPSWKKV 691
            MV+ +Y P +AS KR +V L+EK + FET  VDL+KGE R PEYL +QPFG +PV+ DGD+ ++ESRAI+RY AEKYRSQG +LLGKTIEERG VEQWL+VEA +YHPP+  +T+ ++FA  +G   DEK++K+SEEKL +VLDVYE +LSK+ YLAGDF SLADL+HLPFT+YLVGP+ K ++I+DRKHVSAWWD IS+R +WK+V
Sbjct:    1 MVLTIYAPLFASSKRAVVTLVEKGVSFETVNVDLMKGEQRQPEYLAIQPFGKIPVLVDGDYKIFESRAIMRYIAEKYRSQGPDLLGKTIEERGQVEQWLDVEATSYHPPLLALTLNIVFAPLMGFPADEKVIKESEEKLAEVLDVYEAQLSKNEYLAGDFVSLADLAHLPFTEYLVGPIGKAHLIKDRKHVSAWWDKISSRAAWKEV 207          
BLAST of CK934228 vs. ExPASy Swiss-Prot
Match: GSTF7_ARATH (Glutathione S-transferase OS=Arabidopsis thaliana GN=At3g03190 PE=2 SV=1)

HSP 1 Score: 205.682 bits (522), Expect = 2.878e-52
Identity = 100/208 (48.08%), Postives = 143/208 (68.75%), Query Frame = 2
Query:   71 MVVKVYGPAYAS-PKRVIVCLIEKQIEFETAPVDLIKGEHRNPEYLKLQPFGALPVIQDGDFTLYESRAIIRYYAEKYRSQGTELLGKTIEERGLVEQWLEVEAHNYHPPIYEMTVQLLFASKLGLSVDEKLVKKSEEKLGKVLDVYEERLSKSNYLAGDFFSLADLSHLPFTQYLVGPMEKEYMIRDRKHVSAWWDDISNRPSWKKV 691
            MVVKVYG   A+ P+RV++C +EK IEFE   VDL K E + P++L  QPFG +P I+DG   L+ESRAI RYYA KY  QGT+LLGKT+E R +V+QW+EVE + ++     + + ++F  K G   D  LV++ + K  KVLDVYE RL+ + YL GD F+LADLSH+P  +Y++       ++  R++++ WW++IS RP+WKK+
Sbjct:    1 MVVKVYGQIKAANPQRVLLCFLEKDIEFEVIHVDLDKLEQKKPQHLLRQPFGQVPAIEDGYLKLFESRAIARYYATKYADQGTDLLGKTLEGRAIVDQWVEVENNYFYAVALPLVMNVVFKPKSGKPCDVALVEELKVKFDKVLDVYENRLATNRYLGGDEFTLADLSHMPGMRYIMNETSLSGLVTSRENLNRWWNEISARPAWKKL 208          
BLAST of CK934228 vs. ExPASy Swiss-Prot
Match: GSTF_HYOMU (Glutathione S-transferase OS=Hyoscyamus muticus PE=1 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 3.767e-44
Identity = 89/207 (43.00%), Postives = 128/207 (61.84%), Query Frame = 2
Query:   71 MVVKVYGPAYA-SPKRVIVCLIEKQIEFETAPVDLIKGEHRNPEYLKLQPFGALPVIQDGDFTLYESRAIIRYYAEKYRSQGTELLGKTIEERGLVEQWLEVEAHNYHPPIYEMTVQLLFASKLGLSVDEKLVKKSEEKLGKVLDVYEERLSKSNYLAGDFFSLADLSHLPFTQYLVGPMEKEYMIRDRKHVSAWWDDISNRPSWKK 688
            M +K++GPA + +  RVI  L EK ++FE  PV++  G+H+   ++ L PFG +P  +DGD  L+ESRAI +Y A  Y  +G +LL    ++  ++  W+EVE+  + P   ++T +++    LG+  D+  V ++EEKLGKVLDVYE RL  S YL GD F+LADL H P   YL+G   K  +   R HVSAW  DI  RP+W K
Sbjct:    1 MGMKLHGPAMSPAVMRVIATLKEKDLDFELVPVNMQAGDHKKEPFITLNPFGQVPAFEDGDLKLFESRAITQYIAHTYADKGNQLLANDPKKMAIMSVWMEVESQKFDPVASKLTFEIVIKPMLGMVTDDAAVAENEEKLGKVLDVYESRLKDSKYLGGDSFTLADLHHAPAMNYLMGTKVKS-LFDSRPHVSAWCADILARPAWSK 206          
BLAST of CK934228 vs. ExPASy Swiss-Prot
Match: GSTF_SILCU (Glutathione S-transferase OS=Silene cucubalus GN=GST PE=1 SV=3)

HSP 1 Score: 177.948 bits (450), Expect = 6.426e-44
Identity = 93/210 (44.29%), Postives = 131/210 (62.38%), Query Frame = 2
Query:   71 MVVKVYG-PAYASPKRVIVCLIEKQIEFETAPVDLIKGEHRNPEYLKLQPFGALPVIQDGDFTLYESRAIIRY--YAEKYRSQGTELLGKTIEERGLVEQWLEVEAHNYHPPIYEMTVQLLFASKLGLSVDEKLVKKSEEKLGKVLDVYEERLSKSNYL-AGDFFSLADLSHLPFTQYLVGPMEKEYMIRDRKHVSAWWDDISNRPSWKK 688
            M +KV+G P   + +RV+V L EK +EFE  P+D+  G H+ P YL L PFG +P ++DG+  L+ESRAI +Y  Y   ++++GT L+ K   E      W EVEAH + P   ++  +L+F    G+  D  +V+++E KL KVLDVYE RL++S YL A D F+L DL HLP   YL+G   K+ +  +R HVSAW   I  RPSW+K
Sbjct:    1 MTIKVHGNPRSTATQRVLVALYEKHLEFEFVPIDMGAGGHKQPSYLALNPFGQVPALEDGEIKLFESRAITKYLAYTHDHQNEGTSLIHKEKHEMAAQLVWEEVEAHQFDPVASKLAWELVFKGIFGMQTDTTVVEENEAKLAKVLDVYEARLTESEYLGANDSFTLVDLHHLPLLGYLMGTQVKK-LFEERAHVSAWCKKILARPSWEK 209          
BLAST of CK934228 vs. ExPASy Swiss-Prot
Match: GSTF2_TOBAC (Glutathione S-transferase APIC OS=Nicotiana tabacum GN=APIC PE=2 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 1.096e-43
Identity = 89/207 (43.00%), Postives = 127/207 (61.35%), Query Frame = 2
Query:   71 MVVKVYG-PAYASPKRVIVCLIEKQIEFETAPVDLIKGEHRNPEYLKLQPFGALPVIQDGDFTLYESRAIIRYYAEKYRSQGTELLGKTIEERGLVEQWLEVEAHNYHPPIYEMTVQLLFASKLGLSVDEKLVKKSEEKLGKVLDVYEERLSKSNYLAGDFFSLADLSHLPFTQYLVGPMEKEYMIRDRKHVSAWWDDISNRPSWKK 688
            M +KV+G P   +  RV  CLIEK ++FE  PVD++ GEH+   YL L PFG +P  +DGD  L+ESRAI +Y A  Y   G +L+ +  ++  ++  W+EVE   + P   ++T +L     +G++ D+  VK+SE +L KVLD+YE RL++S YL GD F+L DL H+P   YL+    KE +   R  VSAW  DI  RP+W K
Sbjct:    1 MAIKVHGSPMSTATMRVAACLIEKDLDFELVPVDMVSGEHKKHPYLSLNPFGQVPAFEDGDLKLFESRAITQYIAHVYADNGYQLILQDPKKMPIMSVWMEVEGQKFEPHASKLTWELGIKPIIGMTTDDDAVKESEVQLSKVLDIYETRLAESKYLGGDSFTLVDLHHIPNIYYLMSTKVKE-VFDSRPRVSAWCADILARPAWVK 206          
BLAST of CK934228 vs. ExPASy Swiss-Prot
Match: GSTF1_TOBAC (Glutathione S-transferase PARB OS=Nicotiana tabacum GN=PARB PE=2 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 1.432e-43
Identity = 89/207 (43.00%), Postives = 127/207 (61.35%), Query Frame = 2
Query:   71 MVVKVYG-PAYASPKRVIVCLIEKQIEFETAPVDLIKGEHRNPEYLKLQPFGALPVIQDGDFTLYESRAIIRYYAEKYRSQGTELLGKTIEERGLVEQWLEVEAHNYHPPIYEMTVQLLFASKLGLSVDEKLVKKSEEKLGKVLDVYEERLSKSNYLAGDFFSLADLSHLPFTQYLVGPMEKEYMIRDRKHVSAWWDDISNRPSWKK 688
            M +KV+G P   +  RV  CLIEK+++FE  PVD+  GEH+   YL L PFG +P  +DGD  L+ESRAI +Y A  Y   G +L+ +  ++   +  W+EVE   + PP  ++T +L     +G++ D+  VK+SE +L KVLD+YE +L++S YL GD F+L DL H+P   YL+    KE +   R  VSAW  DI  RP+W K
Sbjct:    1 MAIKVHGSPMSTATMRVAACLIEKELDFEFVPVDMASGEHKKHPYLSLNPFGQVPAFEDGDLKLFESRAITQYIAHVYADNGYQLILQDPKKMPSMSVWMEVEGQKFEPPATKLTWELGIKPIIGMTTDDAAVKESEAQLSKVLDIYETQLAESKYLGGDSFTLVDLHHIPNIYYLMSSKVKE-VFDSRPRVSAWCADILARPAWVK 206          
BLAST of CK934228 vs. ExPASy Swiss-Prot
Match: GSTF3_MAIZE (Glutathione S-transferase 3 OS=Zea mays GN=GST3 PE=1 SV=4)

HSP 1 Score: 171.785 bits (434), Expect = 4.605e-42
Identity = 92/205 (44.88%), Postives = 125/205 (60.98%), Query Frame = 2
Query:   77 VKVYG-PAYASPKRVIVCLIEKQIEFETAPVDLIKGEHRNPEYLKLQPFGALPVIQDGDFTLYESRAIIRYYAEKYRSQGTELLGKTIEERGLVEQWLEVEAHNYHPPIYEMTVQLLFASKLGLSVDEKLVKKSEEKLGKVLDVYEERLSKSNYLAGDFFSLADLSHLPFTQYLVGPMEKEYMIRDRKHVSAWWDDISNRPSWKK 688
            +K+YG P   +  RV   L EK ++FE  PVDL  G H+ P++L L PFG +P + DGD  L+ESRAI RY A KY S+GT+LL  T     L E WLEVE+H++HP    +  QLL    LG + D  +V+K  E+L KVLDVYE  L+++ YLAGD F+LAD +H            +   +  R HV AWW+ I+ RP+++K
Sbjct:    4 LKLYGMPLSPNVVRVATVLNEKGLDFEIVPVDLTTGAHKQPDFLALNPFGQIPALVDGDEVLFESRAINRYIASKYASEGTDLLPATASAAKL-EVWLEVESHHFHPNASPLVFQLLVRPLLGGAPDAAVVEKHAEQLAKVLDVYEAHLARNKYLAGDEFTLADANHALLPALTSARPPRPGCVAARPHVKAWWEAIAARPAFQK 207          
BLAST of CK934228 vs. ExPASy Swiss-Prot
Match: GSTF1_ORYSJ (Probable glutathione S-transferase GSTF1 OS=Oryza sativa subsp. japonica GN=GSTF1 PE=1 SV=2)

HSP 1 Score: 171.014 bits (432), Expect = 7.856e-42
Identity = 93/211 (44.08%), Postives = 131/211 (62.09%), Query Frame = 2
Query:   77 VKVYGPAYASP-KRVIVCLIEKQIEFETAPVDLIKGEHRNPEYLKLQPFGALPVIQDGDFTLYESRAIIRYYAEKYRSQGTELLGK-TIEERGLVEQWLEVEAHNYH----PPIYEMTVQLLFASKLGLSVDEKLVKKSEEKLGKVLDVYEERLSKSNYLAGDFFSLADLSHLPFTQYLVGPMEKEYMIRDRKHVSAWWDDISNRPSWKKV 691
            VKV+GPA ++   RV++CL E   E+E   VD    EH++PE+LK  PFG +P  QDGD  L+ESRAI +Y   KY+++  +LL +  + E  +V+ W EVE H Y+    P +YE  +     +  G+  ++K+V +S EKL KVL+VYE RLS+S YLAGDF S ADL+H P+T Y +G      +     HV AWW+ +  RPS KK+
Sbjct:    4 VKVFGPAQSTNVARVLLCLEEVGAEYEVVNVDFTVMEHKSPEHLKRNPFGQIPAFQDGDLYLFESRAIGKYILRKYKTREADLLREGNLREAAMVDVWTEVETHQYNSAISPIVYECIIN---PAMRGIPTNQKVVDESAEKLKKVLEVYEARLSQSTYLAGDFVSFADLNHFPYTFYFMGTPYAS-LFDSYPHVKAWWERLMARPSVKKL 210          
BLAST of CK934228 vs. ExPASy Swiss-Prot
Match: GSTF6_ARATH (Glutathione S-transferase 6, chloroplastic OS=Arabidopsis thaliana GN=GST6 PE=1 SV=3)

HSP 1 Score: 169.474 bits (428), Expect = 2.286e-41
Identity = 87/207 (42.03%), Postives = 127/207 (61.35%), Query Frame = 2
Query:   77 VKVYG-PAYASPKRVIVCLIEKQIEFETAPVDLIKGEHRNPEYLKLQPFGALPVIQDGDFTLYESRAIIRYYAEKYRSQGTELLGKTIEE-RGLVEQWLEVEAHNYHPPIYEMTVQLLFASKLGLSVDEKLVKKSEEKLGKVLDVYEERLSKSNYLAGDFFSLADLSHLPFTQYLVGPMEKEYMIRDRKHVSAWWDDISNRPSWKKV 691
            +KV+G P   +  RV+  L EK ++FE  PVD+  G H+   +L L PFG +P ++DGD TL+ESRAI +Y AE+Y  +G +L+ +  ++ +     WL+VE   + P   ++  + +F    G++ D   V++ E KL KVLDVYE RL+KS +LAGD F+LADL HLP   YL+G  + + +   R  VS W   IS RP+W KV
Sbjct:   52 IKVHGVPMSTATMRVLATLYEKDLQFELIPVDMRAGAHKQEAHLALNPFGQIPALEDGDLTLFESRAITQYLAEEYSEKGEKLISQDCKKVKATTNVWLQVEGQQFDPNASKLAFERVFKGMFGMTTDPAAVQELEGKLQKVLDVYEARLAKSEFLAGDSFTLADLHHLPAIHYLLG-TDSKVLFDSRPKVSEWIKKISARPAWAKV 257          
BLAST of CK934228 vs. ExPASy Swiss-Prot
Match: GST16_ARATH (Glutathione S-transferase 16 OS=Arabidopsis thaliana GN=GST16 PE=1 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 8.685e-41
Identity = 87/209 (41.63%), Postives = 130/209 (62.20%), Query Frame = 2
Query:   77 VKVYG-PAYASPKRVIVCLIEKQIEFETAPVDLIKGEHRNPEYLKLQPFGALPVIQDGDFTLYESRAIIRYYAEKYRSQGTELL---GKTIEERGLVEQWLEVEAHNYHPPIYEMTVQLLFASKLGLSVDEKLVKKSEEKLGKVLDVYEERLSKSNYLAGDFFSLADLSHLPFTQYLVGPMEKEYMIRDRKHVSAWWDDISNRPSWKKV 691
            +KV+G PA  S +RV++ L EK ++FE   V+L  GEH+   +L   PFG +P  +DGD  L+ESRAI +Y A +Y +QGT LL    K I +  ++   ++VEAH + P   ++  + +F    GL+ D+ +V + E KL KVLDVYE RL +  YLAG+ F+L DL H+P  QYL+G   K+ +  +R  V+ W  +I+ RP+ +KV
Sbjct:    4 IKVFGHPASTSTRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLFESRAITQYIAHRYENQGTNLLPADSKNIAQYAIMSIGIQVEAHQFDPVASKLAWEQVFKFNYGLNTDQAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPVIQYLLGTPTKK-LFTERPRVNEWVAEITKRPASEKV 211          
The following BLAST results are available for this feature:
BLAST of CK934228 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 38
Match NameE-valueIdentityDescription
GSTF3_ARATH5.209e-7864.25Glutathione S-transferase ERD13 OS=Arabidopsis tha... [more]
GSTF7_ARATH2.878e-5248.08Glutathione S-transferase OS=Arabidopsis thaliana ... [more]
GSTF_HYOMU3.767e-4443.00Glutathione S-transferase OS=Hyoscyamus muticus PE... [more]
GSTF_SILCU6.426e-4444.29Glutathione S-transferase OS=Silene cucubalus GN=G... [more]
GSTF2_TOBAC1.096e-4343.00Glutathione S-transferase APIC OS=Nicotiana tabacu... [more]
GSTF1_TOBAC1.432e-4343.00Glutathione S-transferase PARB OS=Nicotiana tabacu... [more]
GSTF3_MAIZE4.605e-4244.88Glutathione S-transferase 3 OS=Zea mays GN=GST3 PE... [more]
GSTF1_ORYSJ7.856e-4244.08Probable glutathione S-transferase GSTF1 OS=Oryza ... [more]
GSTF6_ARATH2.286e-4142.03Glutathione S-transferase 6, chloroplastic OS=Arab... [more]
GST16_ARATH8.685e-4141.63Glutathione S-transferase 16 OS=Arabidopsis thalia... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004261_H05 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10004_IVF_H05 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK934228 ID=CK934228|Name=CK934228|organism=Citrus sinensis|type=EST|length=879bp
GGGGACAAACTCACTCACTGCTTTTTATTGAGAGAAAAAGTTAAGAAAGA
GAATAGCAAAAGCAACAACAATGGTGGTAAAGGTGTATGGTCCAGCTTAT
GCTTCTCCCAAACGGGTGATTGTGTGCTTGATTGAGAAGCAAATCGAATT
TGAAACTGCTCCCGTTGATCTCATCAAAGGAGAGCATAGAAATCCTGAGT
ACCTCAAATTGCAGCCTTTCGGAGCTCTTCCTGTCATTCAAGATGGAGAT
TTTACGTTATACGAATCTCGAGCTATCATAAGGTACTACGCCGAAAAGTA
CAGGTCTCAAGGAACCGAACTTCTGGGAAAAACAATTGAAGAAAGAGGCC
TGGTGGAACAATGGCTAGAAGTAGAGGCACACAACTATCACCCGCCAATT
TACGAGATGACCGTGCAACTTTTATTTGCCTCCAAGTTGGGACTTTCTGT
TGATGAAAAATTGGTAAAAAAGAGTGAAGAAAAGCTTGGAAAAGTTCTCG
ATGTTTACGAGGAGAGGCTCTCAAAGAGCAATTATTTGGCTGGTGATTTC
TTCAGCCTGGCTGATCTGAGTCACCTTCCTTTTACTCAATACTTGGTTGG
GCCGATGGAGAAGGAGTACATGATTAGAGACAGAAAGCATGTGAGTGCTT
GGTGGGATGATATTAGCAACAGGCCATCCTGGAAGAAAGTCCTTGAGCTT
TATTAGCTACTTTGGCTGAGCTTGATTTCATGTAATAATAATCGTGGGGC
TTGTGTTTTTACTCCTGCCTCCTAGTTTGTTCATGTGTTTGGCGATATGT
ATCTTTCTTGTGTCTTTTTGGTTTTTATAAATAAATGCTTGGGGCCTTGG
GAGAAAAAAAAAAAAAAAAAAAAAAAAAA
back to top