CK935892
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CK935892 vs. ExPASy Swiss-Prot
Match: PRS6B_SOLTU (26S protease regulatory subunit 6B homolog OS=Solanum tuberosum PE=2 SV=1) HSP 1 Score: 85.8853 bits (211), Expect = 8.822e-17 Identity = 39/39 (100.00%), Postives = 39/39 (100.00%), Query Frame = 2 Query: 5 QEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 121 QEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK Sbjct: 375 QEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 413
BLAST of CK935892 vs. ExPASy Swiss-Prot
Match: PRS6B_ARATH (26S protease regulatory subunit 6B homolog OS=Arabidopsis thaliana GN=RPT3 PE=1 SV=1) HSP 1 Score: 83.9593 bits (206), Expect = 3.352e-16 Identity = 38/39 (97.44%), Postives = 38/39 (97.44%), Query Frame = 2 Query: 5 QEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 121 QEAGMHAVRKNRYVILPKDFEKGYR NVKKPDTDFEFYK Sbjct: 370 QEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 408
BLAST of CK935892 vs. ExPASy Swiss-Prot
Match: PRS6B_MANSE (26S protease regulatory subunit 6B OS=Manduca sexta PE=2 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 1.457e-11 Identity = 27/39 (69.23%), Postives = 37/39 (94.87%), Query Frame = 2 Query: 5 QEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 121 QEAGM+AVR+NRY++LPKDFEKGY+ N+KK ++++EFYK Sbjct: 377 QEAGMNAVRENRYIVLPKDFEKGYKNNIKKDESEYEFYK 415
BLAST of CK935892 vs. ExPASy Swiss-Prot
Match: PRS6B_DICDI (26S protease regulatory subunit 6B homolog OS=Dictyostelium discoideum GN=psmC4 PE=1 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 9.447e-11 Identity = 28/38 (73.68%), Postives = 33/38 (86.84%), Query Frame = 2 Query: 5 QEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFY 118 QEAGMHA+RKNRYVILPKDFEKGY+ ++KK +F FY Sbjct: 365 QEAGMHAIRKNRYVILPKDFEKGYKASIKKNTHEFNFY 402 The following BLAST results are available for this feature:
BLAST of CK935892 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 4
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CK935892 ID=CK935892; Name=CK935892; organism=Citrus sinensis; type=EST; length=458bpback to top |