EY736122
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY736122 vs. ExPASy Swiss-Prot
Match: HAL3A_ARATH (Phosphopantothenoylcysteine decarboxylase OS=Arabidopsis thaliana GN=HAL3A PE=1 SV=1) HSP 1 Score: 80.4925 bits (197), Expect = 4.847e-19 Identity = 41/54 (75.93%), Postives = 45/54 (83.33%), Query Frame = 1 Query: 232 DWEAMQVNTGLRKPRILLAASGSVAAIKFGNLCHCFAEWAEVRAVGEKVLSTLH 393 D + M+VNT RKPR+LLAASGSVAAIKFGNLCHCF EWAEVRAV K S+LH Sbjct: 7 DRQDMEVNTTPRKPRVLLAASGSVAAIKFGNLCHCFTEWAEVRAVVTK--SSLH 58 HSP 2 Score: 30.4166 bits (67), Expect = 4.847e-19 Identity = 11/20 (55.00%), Postives = 17/20 (85.00%), Query Frame = 2 Query: 374 RSSLHFIDRAALPKDVIFYT 433 +SSLHF+D+ +LP++V YT Sbjct: 54 KSSLHFLDKLSLPQEVTLYT 73 HSP 3 Score: 22.7126 bits (47), Expect = 4.847e-19 Identity = 8/12 (66.67%), Postives = 10/12 (83.33%), Query Frame = 3 Query: 435 DEDEWASGGEIG 470 DEDEW+S +IG Sbjct: 74 DEDEWSSWNKIG 85
BLAST of EY736122 vs. ExPASy Swiss-Prot
Match: HAL3B_ARATH (Probable phosphopantothenoylcysteine decarboxylase OS=Arabidopsis thaliana GN=HAL3B PE=2 SV=2) HSP 1 Score: 73.9442 bits (180), Expect = 1.114e-16 Identity = 34/44 (77.27%), Postives = 39/44 (88.64%), Query Frame = 1 Query: 244 MQVNTGLRKPRILLAASGSVAAIKFGNLCHCFAEWAEVRAVGEK 375 M+V+T RKPRILLAASGSVA+IKF NLCHCF+EWAEV+AV K Sbjct: 3 MEVDTVTRKPRILLAASGSVASIKFSNLCHCFSEWAEVKAVASK 46 HSP 2 Score: 28.8758 bits (63), Expect = 1.114e-16 Identity = 11/22 (50.00%), Postives = 18/22 (81.82%), Query Frame = 2 Query: 368 ARRSSLHFIDRAALPKDVIFYT 433 A +SSL+F+D+ +LP++V YT Sbjct: 44 ASKSSLNFVDKPSLPQNVTLYT 65 HSP 3 Score: 22.7126 bits (47), Expect = 1.114e-16 Identity = 8/12 (66.67%), Postives = 10/12 (83.33%), Query Frame = 3 Query: 435 DEDEWASGGEIG 470 DEDEW+S +IG Sbjct: 66 DEDEWSSWNKIG 77 The following BLAST results are available for this feature:
BLAST of EY736122 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >EY736122 ID=EY736122; Name=EY736122; organism=Citrus sinensis; type=EST; length=863bpback to top |