EY728469
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY728469 vs. ExPASy Swiss-Prot
Match: P2C39_ORYSJ (Probable protein phosphatase 2C 39 OS=Oryza sativa subsp. japonica GN=Os04g0403701 PE=2 SV=2) HSP 1 Score: 66.6254 bits (161), Expect = 2.956e-13 Identity = 32/43 (74.42%), Postives = 35/43 (81.40%), Query Frame = 3 Query: 633 KNSSFSCLSGAALSANATLAYTNICNGLIXAEILPXLDSPNHF 761 +N SF+CLSGAA+SAN TLA TNIC GLI EILP LDSPN F Sbjct: 69 QNGSFTCLSGAAISANFTLANTNICKGLIGEEILPELDSPNSF 111 HSP 2 Score: 29.6462 bits (65), Expect = 2.956e-13 Identity = 14/38 (36.84%), Postives = 22/38 (57.89%), Query Frame = 1 Query: 505 QQQRMMNSEGELKVSFGYQCNGHRDGSCEVPDGYNIVP 618 ++ ++ S L VSFGY CN ++ S + D Y+I P Sbjct: 20 EEDMLVRSYSNLNVSFGYHCNSYQCFSLDT-DEYDISP 56
BLAST of EY728469 vs. ExPASy Swiss-Prot
Match: P2C40_ARATH (Probable protein phosphatase 2C 40 OS=Arabidopsis thaliana GN=At3g16560 PE=2 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 1.147e-11 Identity = 33/45 (73.33%), Postives = 36/45 (80.00%), Query Frame = 3 Query: 627 IXKNSSFSCLSGAALSANATLAYTNICNGLIXAEILPXLDSPNHF 761 + K SSFSCLSGAALS N TLA TNICNG+I +EILP LDSP F Sbjct: 43 LQKTSSFSCLSGAALSGNPTLANTNICNGVIGSEILPSLDSPKSF 87 HSP 2 Score: 22.7126 bits (47), Expect = 1.147e-11 Identity = 11/25 (44.00%), Postives = 17/25 (68.00%), Query Frame = 2 Query: 734 PXFGLPQSFRRVPRLXSI-KVDMLS 805 P P+SFR+VP ++ K+D+LS Sbjct: 79 PSLDSPKSFRKVPSSPALSKLDILS 103 The following BLAST results are available for this feature:
BLAST of EY728469 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >EY728469 ID=EY728469; Name=EY728469; organism=Citrus sinensis; type=EST; length=917bpback to top |