EY692965
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY692965 vs. ExPASy Swiss-Prot
Match: GCP3_XENLA (Gamma-tubulin complex component 3 homolog OS=Xenopus laevis GN=tubgcp3 PE=1 SV=1) HSP 1 Score: 55.8398 bits (133), Expect = 4.044e-14 Identity = 29/60 (48.33%), Postives = 39/60 (65.00%), Query Frame = 3 Query: 30 HLLDVIYKIYKF*EHWLAI*LYLLLGESDFGHNLMDIGGPKLSDPANTINSYKLAGLLET 209 +LLDV+ K Y EH A+ YLLLG+ DF +LMD+ P+L PA T+ + L G+LET Sbjct: 543 YLLDVLNKNYNLLEHMQAMRRYLLLGQGDFIRHLMDLLKPELVRPATTLYQHNLTGILET 602 HSP 2 Score: 36.1946 bits (82), Expect = 4.044e-14 Identity = 15/36 (41.67%), Postives = 23/36 (63.89%), Query Frame = 2 Query: 296 GDTGCYVFSLQYYARVPLDTLIPHPVIATYIKIFNF 403 GDTG VFSL Y+ P+ T+ ++ Y+++FNF Sbjct: 630 GDTGWDVFSLDYHVDGPIATVFTRECMSHYLRVFNF 665 HSP 3 Score: 26.5646 bits (57), Expect = 4.044e-14 Identity = 9/19 (47.37%), Postives = 16/19 (84.21%), Query Frame = 1 Query: 211 AIRTSNAQYDDPDILDHVE 267 A+R +NAQ+D+P+IL ++ Sbjct: 603 AVRATNAQFDNPEILKRLD 621
BLAST of EY692965 vs. ExPASy Swiss-Prot
Match: GCP3_MOUSE (Gamma-tubulin complex component 3 OS=Mus musculus GN=Tubgcp3 PE=2 SV=2) HSP 1 Score: 55.8398 bits (133), Expect = 5.230e-14 Identity = 29/60 (48.33%), Postives = 39/60 (65.00%), Query Frame = 3 Query: 30 HLLDVIYKIYKF*EHWLAI*LYLLLGESDFGHNLMDIGGPKLSDPANTINSYKLAGLLET 209 +LLDV+ K Y EH A+ YLLLG+ DF +LMD+ P+L PA T+ + L G+LET Sbjct: 542 YLLDVLNKKYSLLEHMQAMRRYLLLGQGDFIRHLMDLLKPELVRPATTLYQHNLTGILET 601 HSP 2 Score: 36.1946 bits (82), Expect = 5.230e-14 Identity = 15/36 (41.67%), Postives = 23/36 (63.89%), Query Frame = 2 Query: 296 GDTGCYVFSLQYYARVPLDTLIPHPVIATYIKIFNF 403 GDTG VFSL Y+ P+ T+ ++ Y+++FNF Sbjct: 629 GDTGWDVFSLDYHVDGPIATVFTRECMSHYLRVFNF 664 HSP 3 Score: 26.1794 bits (56), Expect = 5.230e-14 Identity = 9/19 (47.37%), Postives = 15/19 (78.95%), Query Frame = 1 Query: 211 AIRTSNAQYDDPDILDHVE 267 A+R +NAQ+D P+IL ++ Sbjct: 602 AVRATNAQFDSPEILKRLD 620
BLAST of EY692965 vs. ExPASy Swiss-Prot
Match: GCP3_HUMAN (Gamma-tubulin complex component 3 OS=Homo sapiens GN=TUBGCP3 PE=1 SV=2) HSP 1 Score: 54.6842 bits (130), Expect = 1.462e-13 Identity = 28/60 (46.67%), Postives = 39/60 (65.00%), Query Frame = 3 Query: 30 HLLDVIYKIYKF*EHWLAI*LYLLLGESDFGHNLMDIGGPKLSDPANTINSYKLAGLLET 209 +LLDV+ K Y +H A+ YLLLG+ DF +LMD+ P+L PA T+ + L G+LET Sbjct: 544 YLLDVLNKKYSLLDHMQAMRRYLLLGQGDFIRHLMDLLKPELVRPATTLYQHNLTGILET 603 HSP 2 Score: 36.1946 bits (82), Expect = 1.462e-13 Identity = 15/36 (41.67%), Postives = 23/36 (63.89%), Query Frame = 2 Query: 296 GDTGCYVFSLQYYARVPLDTLIPHPVIATYIKIFNF 403 GDTG VFSL Y+ P+ T+ ++ Y+++FNF Sbjct: 631 GDTGWDVFSLDYHVDGPIATVFTRECMSHYLRVFNF 666 HSP 3 Score: 25.7942 bits (55), Expect = 1.462e-13 Identity = 9/19 (47.37%), Postives = 15/19 (78.95%), Query Frame = 1 Query: 211 AIRTSNAQYDDPDILDHVE 267 A+R +NAQ+D P+IL ++ Sbjct: 604 AVRATNAQFDSPEILRRLD 622 The following BLAST results are available for this feature:
BLAST of EY692965 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >EY692965 ID=EY692965; Name=EY692965; organism=Citrus sinensis; type=EST; length=935bpback to top |