EY684968
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY684968 vs. ExPASy Swiss-Prot
Match: CSK2C_ARATH (Casein kinase II subunit beta' OS=Arabidopsis thaliana GN=CKB2 PE=1 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 1.165e-11 Identity = 32/42 (76.19%), Postives = 33/42 (78.57%), Query Frame = 3 Query: 6 IDGAYFGTTIPLLFLMTYGHLMPLKAVQSYAPRGFGF*IHKP 131 IDGAYFGTT P LFLMTYGHL P KA QSY R FGF +HKP Sbjct: 241 IDGAYFGTTFPHLFLMTYGHLKPQKASQSYTQRVFGFKLHKP 282
BLAST of EY684968 vs. ExPASy Swiss-Prot
Match: CSK2B_ARATH (Casein kinase II subunit beta OS=Arabidopsis thaliana GN=CKB1 PE=1 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 1.165e-11 Identity = 31/42 (73.81%), Postives = 33/42 (78.57%), Query Frame = 3 Query: 6 IDGAYFGTTIPLLFLMTYGHLMPLKAVQSYAPRGFGF*IHKP 131 IDGAYFGTT P LFLMTYGHL P KA Q+Y R FGF +HKP Sbjct: 246 IDGAYFGTTFPHLFLMTYGHLKPAKATQNYVQRVFGFKLHKP 287
BLAST of EY684968 vs. ExPASy Swiss-Prot
Match: CSK2D_ARATH (Casein kinase II subunit beta-3 OS=Arabidopsis thaliana GN=CKB3 PE=1 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 4.426e-11 Identity = 30/42 (71.43%), Postives = 33/42 (78.57%), Query Frame = 3 Query: 6 IDGAYFGTTIPLLFLMTYGHLMPLKAVQSYAPRGFGF*IHKP 131 IDGAYFGTT P LFLMTYG+L P K QSY P+ FGF +HKP Sbjct: 235 IDGAYFGTTFPHLFLMTYGNLKPQKPTQSYVPKIFGFKVHKP 276 The following BLAST results are available for this feature:
BLAST of EY684968 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >EY684968 ID=EY684968; Name=EY684968; organism=Citrus sinensis; type=EST; length=356bpback to top |