EY684317
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY684317 vs. ExPASy Swiss-Prot
Match: CSD2B_XENLA (CDGSH iron sulfur domain-containing protein 2-B OS=Xenopus laevis GN=cisd2-B PE=2 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 3.174e-13 Identity = 30/37 (81.08%), Postives = 34/37 (91.89%), Query Frame = 3 Query: 66 AYCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLKKQ 176 AYCRCWRS TFP+CDGSH KHN+ TGDNVGPL+LKK+ Sbjct: 97 AYCRCWRSKTFPVCDGSHNKHNELTGDNVGPLILKKK 133
BLAST of EY684317 vs. ExPASy Swiss-Prot
Match: CSD2A_XENLA (CDGSH iron sulfur domain-containing protein 2-A OS=Xenopus laevis GN=cisd2-A PE=2 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 3.174e-13 Identity = 30/37 (81.08%), Postives = 34/37 (91.89%), Query Frame = 3 Query: 66 AYCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLKKQ 176 AYCRCWRS TFP+CDGSH KHN+ TGDNVGPL+LKK+ Sbjct: 97 AYCRCWRSKTFPVCDGSHNKHNELTGDNVGPLILKKK 133
BLAST of EY684317 vs. ExPASy Swiss-Prot
Match: CISD2_XENTR (CDGSH iron sulfur domain-containing protein 2 OS=Xenopus tropicalis GN=cisd2 PE=2 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 3.174e-13 Identity = 30/37 (81.08%), Postives = 34/37 (91.89%), Query Frame = 3 Query: 66 AYCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLKKQ 176 AYCRCWRS TFP+CDGSH KHN+ TGDNVGPL+LKK+ Sbjct: 97 AYCRCWRSKTFPVCDGSHNKHNELTGDNVGPLILKKK 133
BLAST of EY684317 vs. ExPASy Swiss-Prot
Match: CISD2_MOUSE (CDGSH iron sulfur domain-containing protein 2 OS=Mus musculus GN=Cisd2 PE=2 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 5.415e-13 Identity = 30/37 (81.08%), Postives = 33/37 (89.19%), Query Frame = 3 Query: 66 AYCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLKKQ 176 AYCRCWRS TFP CDGSH KHN+ TGDNVGPL+LKK+ Sbjct: 97 AYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKK 133
BLAST of EY684317 vs. ExPASy Swiss-Prot
Match: CISD2_HUMAN (CDGSH iron sulfur domain-containing protein 2 OS=Homo sapiens GN=CISD2 PE=1 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 5.415e-13 Identity = 30/37 (81.08%), Postives = 33/37 (89.19%), Query Frame = 3 Query: 66 AYCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLKKQ 176 AYCRCWRS TFP CDGSH KHN+ TGDNVGPL+LKK+ Sbjct: 97 AYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKK 133
BLAST of EY684317 vs. ExPASy Swiss-Prot
Match: CISD2_BOVIN (CDGSH iron sulfur domain-containing protein 2 OS=Bos taurus GN=CISD2 PE=2 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 5.415e-13 Identity = 30/37 (81.08%), Postives = 33/37 (89.19%), Query Frame = 3 Query: 66 AYCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLKKQ 176 AYCRCWRS TFP CDGSH KHN+ TGDNVGPL+LKK+ Sbjct: 97 AYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKK 133
BLAST of EY684317 vs. ExPASy Swiss-Prot
Match: CISD1_BOVIN (CDGSH iron sulfur domain-containing protein 1 OS=Bos taurus GN=CISD1 PE=1 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 1.575e-12 Identity = 28/36 (77.78%), Postives = 32/36 (88.89%), Query Frame = 3 Query: 69 YCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLKKQ 176 YCRCWRS FPLCDGSH KHN+ TGDNVGPL++KK+ Sbjct: 69 YCRCWRSKKFPLCDGSHTKHNEETGDNVGPLIIKKK 104
BLAST of EY684317 vs. ExPASy Swiss-Prot
Match: CISD1_RAT (CDGSH iron sulfur domain-containing protein 1 OS=Rattus norvegicus GN=Cisd1 PE=3 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 4.584e-12 Identity = 26/36 (72.22%), Postives = 32/36 (88.89%), Query Frame = 3 Query: 69 YCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLKKQ 176 YCRCWRS FP CDG+H+KHN+ TGDNVGPL++KK+ Sbjct: 71 YCRCWRSKKFPFCDGAHIKHNEETGDNVGPLIIKKK 106
BLAST of EY684317 vs. ExPASy Swiss-Prot
Match: CISD1_MOUSE (CDGSH iron sulfur domain-containing protein 1 OS=Mus musculus GN=Cisd1 PE=1 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 4.584e-12 Identity = 26/36 (72.22%), Postives = 32/36 (88.89%), Query Frame = 3 Query: 69 YCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLKKQ 176 YCRCWRS FP CDG+H+KHN+ TGDNVGPL++KK+ Sbjct: 71 YCRCWRSKKFPFCDGAHIKHNEETGDNVGPLIIKKK 106
BLAST of EY684317 vs. ExPASy Swiss-Prot
Match: CISD1_HUMAN (CDGSH iron sulfur domain-containing protein 1 OS=Homo sapiens GN=CISD1 PE=1 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.021e-11 Identity = 26/36 (72.22%), Postives = 31/36 (86.11%), Query Frame = 3 Query: 69 YCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLKKQ 176 YCRCWRS FP CDG+H KHN+ TGDNVGPL++KK+ Sbjct: 71 YCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKK 106 The following BLAST results are available for this feature:
BLAST of EY684317 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 10
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >EY684317 ID=EY684317; Name=EY684317; organism=Citrus sinensis; type=EST; length=489bpback to top |