EY684286
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY684286 vs. ExPASy Swiss-Prot
Match: 14KD_DAUCA (14 kDa proline-rich protein DC2.15 OS=Daucus carota PE=2 SV=1) HSP 1 Score: 77.0258 bits (188), Expect = 3.566e-14 Identity = 33/64 (51.56%), Postives = 45/64 (70.31%), Query Frame = 1 Query: 10 NVAVGSPPYSQCCAILGGLGEVEAALCLCLAIKANVLAIELNWPTNIGLILSLCNRPIPAGFKC 201 NV +GSPP CC++L GL +EAA+CLC AIKAN+L LN P + L+L+ C + +P GF+C Sbjct: 73 NVVIGSPPTLPCCSLLEGLVNLEAAVCLCTAIKANILGKNLNLPIALSLVLNNCGKQVPNGFEC 136
BLAST of EY684286 vs. ExPASy Swiss-Prot
Match: CCDP_MAIZE (Cortical cell-delineating protein OS=Zea mays PE=2 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 2.311e-13 Identity = 35/63 (55.56%), Postives = 42/63 (66.67%), Query Frame = 1 Query: 13 VAVGSPPYSQCCAILGGLGEVEAALCLCLAIKANVLAIELNWPTNIGLILSLCNRPIPAGFKC 201 V VG P Y QCC +L GL +++AALCLC AIKANVL I LN P ++ IL+ C R P F C Sbjct: 65 VKVGLPQYEQCCPLLEGLVDLDAALCLCTAIKANVLGIHLNVPLSLNFILNNCGRICPEDFTC 127 The following BLAST results are available for this feature:
BLAST of EY684286 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >EY684286 ID=EY684286; Name=EY684286; organism=Citrus sinensis; type=EST; length=436bpback to top |