EY684275
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY684275 vs. ExPASy Swiss-Prot
Match: FTRV_MAIZE (Ferredoxin-thioredoxin reductase, variable chain OS=Zea mays PE=1 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 1.122e-13 Identity = 31/54 (57.41%), Postives = 41/54 (75.93%), Query Frame = 1 Query: 232 KIGAKVKVKVPLKVYHVPRVPEHDLSGMESVLKQYVSVWKGKKIYTNMPYKVAF 393 KIG +V+V PL+VYHV + P+ D+ GME V+KQYV VWKGK++ N P+KV F Sbjct: 17 KIGRRVRVTAPLRVYHVLKAPDLDIQGMEGVVKQYVCVWKGKRVTANFPFKVEF 70 HSP 2 Score: 24.2534 bits (51), Expect = 1.122e-13 Identity = 11/22 (50.00%), Postives = 15/22 (68.18%), Query Frame = 2 Query: 392 FVTEIEG--RPVKFFDHLKEKE 451 F +EG +PV+FF HL+E E Sbjct: 70 FELAVEGQPKPVRFFAHLREDE 91
BLAST of EY684275 vs. ExPASy Swiss-Prot
Match: FTRV_SPIOL (Ferredoxin-thioredoxin reductase, variable chain, chloroplastic OS=Spinacia oleracea GN=FTRV PE=1 SV=2) HSP 1 Score: 75.485 bits (184), Expect = 5.337e-13 Identity = 42/91 (46.15%), Postives = 54/91 (59.34%), Query Frame = 1 Query: 124 ISCEVAVKSNNSTASVGLEXXXXXXXXXXDDGFDESKIGAKVKVKVPLKVYHVPRVPEHDLS-GMESVLKQYVSVWKGKKIYTNMPYKVAF 393 I CEVA+KS++ST + K+G KVKVK PLKVYHVP++PE +L+ M V+KQYV WKGK I N P+KV + Sbjct: 60 ICCEVALKSDSSTGFDSSSSSPPEEDEELKKNLE--KVGCKVKVKSPLKVYHVPKLPEVELTPDMVGVIKQYVGFWKGKYISPNYPFKVEY 148 The following BLAST results are available for this feature:
BLAST of EY684275 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >EY684275 ID=EY684275; Name=EY684275; organism=Citrus sinensis; type=EST; length=982bpback to top |