EY679917
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY679917 vs. ExPASy Swiss-Prot
Match: SCMC1_MOUSE (Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Mus musculus GN=Slc25a24 PE=2 SV=1) HSP 1 Score: 61.6178 bits (148), Expect = 1.575e-12 Identity = 29/97 (29.90%), Postives = 53/97 (54.64%), Query Frame = 3 Query: 255 ERDIRIRSLFNFFDAANSGYLDYAQIESGLSALQIPAQYKYAKDLFKVCDANRDGRVDYQEFRRYMDIKEMELYKIFQTIDVEHNGCILPEELWDAL 545 E R +LF D G +D +++ GL +L IP + +F D N+DG++D++EF +Y+ E ++ F+++D ++G I P E+ +L Sbjct: 19 EPPTRYETLFRALDRNGDGVVDIGELQQGLQSLGIPLGQDAEEKIFTTGDVNKDGKLDFEEFMKYLKDHEKKMKLAFKSLDKNNDGKIEPSEIVQSL 115 HSP 2 Score: 32.3426 bits (72), Expect = 1.575e-12 Identity = 11/37 (29.73%), Postives = 21/37 (56.76%), Query Frame = 2 Query: 569 GIEISDEELARFVEHVDKDNNGIITFEEWRDFLLLYP 679 G+ IS+++ ++ +D D + + EWRD+ L P Sbjct: 119 GLHISEKQAELILQSIDSDGTMTVDWNEWRDYFLFNP 155
BLAST of EY679917 vs. ExPASy Swiss-Prot
Match: SCMC1_HUMAN (Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Homo sapiens GN=SLC25A24 PE=1 SV=2) HSP 1 Score: 58.9214 bits (141), Expect = 1.651e-11 Identity = 31/109 (28.44%), Postives = 55/109 (50.46%), Query Frame = 3 Query: 219 DHVLLALRESKEERDIRIRSLFNFFDAANSGYLDYAQIESGLSALQIPAQYKYAKDLFKVCDANRDGRVDYQEFRRYMDIKEMELYKIFQTIDVEHNGCILPEELWDAL 545 D VL E+ R +LF D G +D +++ GL L IP + +F D N+DG++D++EF +Y+ E ++ F+++D ++G I E+ +L Sbjct: 7 DFVLPTAACQDAEQPTRYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAEEKIFTTGDVNKDGKLDFEEFMKYLKDHEKKMKLAFKSLDKNNDGKIEASEIVQSL 115 HSP 2 Score: 31.5722 bits (70), Expect = 1.651e-11 Identity = 11/37 (29.73%), Postives = 21/37 (56.76%), Query Frame = 2 Query: 569 GIEISDEELARFVEHVDKDNNGIITFEEWRDFLLLYP 679 G+ IS+++ ++ +D D + + EWRD+ L P Sbjct: 119 GLTISEQQAELILQSIDVDGTMTVDWNEWRDYFLFNP 155
BLAST of EY679917 vs. ExPASy Swiss-Prot
Match: SCMC1_BOVIN (Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Bos taurus GN=SLC25A24 PE=2 SV=1) HSP 1 Score: 58.5362 bits (140), Expect = 1.651e-11 Identity = 28/97 (28.87%), Postives = 53/97 (54.64%), Query Frame = 3 Query: 255 ERDIRIRSLFNFFDAANSGYLDYAQIESGLSALQIPAQYKYAKDLFKVCDANRDGRVDYQEFRRYMDIKEMELYKIFQTIDVEHNGCILPEELWDAL 545 E R +LF D G +D ++++ GL +L IP + +F D N+DG++D++EF +Y+ E ++ F+++D ++G I E+ +L Sbjct: 19 EPPTRYETLFQKLDRNGDGVVDISELQEGLKSLGIPLGQDAEEKIFTTGDVNKDGKLDFEEFMKYLKDHEKKMKLAFKSLDKNNDGKIEASEIVQSL 115 HSP 2 Score: 31.9574 bits (71), Expect = 1.651e-11 Identity = 11/37 (29.73%), Postives = 21/37 (56.76%), Query Frame = 2 Query: 569 GIEISDEELARFVEHVDKDNNGIITFEEWRDFLLLYP 679 G+ IS+++ ++ +D D + + EWRD+ L P Sbjct: 119 GLTISEQQAELILQSIDADGTMTVDWNEWRDYFLFNP 155
BLAST of EY679917 vs. ExPASy Swiss-Prot
Match: SCMC1_RABIT (Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Oryctolagus cuniculus GN=SLC25A24 PE=1 SV=1) HSP 1 Score: 58.151 bits (139), Expect = 2.144e-11 Identity = 28/97 (28.87%), Postives = 52/97 (53.61%), Query Frame = 3 Query: 255 ERDIRIRSLFNFFDAANSGYLDYAQIESGLSALQIPAQYKYAKDLFKVCDANRDGRVDYQEFRRYMDIKEMELYKIFQTIDVEHNGCILPEELWDAL 545 E R +LF D G +D +++ GL +L IP + +F D N+DG++D++EF +Y+ E ++ F+++D ++G I E+ +L Sbjct: 19 EPPTRYETLFQALDRNGDGVVDIRELQEGLKSLGIPLGQDAEEKIFTTGDVNKDGKLDFEEFMKYLKDHEKKMKLAFKSLDKNNDGKIEASEIVQSL 115 HSP 2 Score: 31.9574 bits (71), Expect = 2.144e-11 Identity = 11/37 (29.73%), Postives = 21/37 (56.76%), Query Frame = 2 Query: 569 GIEISDEELARFVEHVDKDNNGIITFEEWRDFLLLYP 679 G+ IS+++ ++ +D D + + EWRD+ L P Sbjct: 119 GLTISEQQAELILQSIDADGTMTVDWNEWRDYFLFNP 155 The following BLAST results are available for this feature:
BLAST of EY679917 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 4
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >EY679917 ID=EY679917; Name=EY679917; organism=Citrus sinensis; type=EST; length=921bpback to top |