EY659499

Overview
NameEY659499
Unique NameEY659499
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length922
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7556 contig Csv1_Contig7556:60..983. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659499 vs. ExPASy Swiss-Prot
Match: PDIA6_ARATH (Probable protein disulfide-isomerase A6 OS=Arabidopsis thaliana GN=At2g47470 PE=1 SV=1)

HSP 1 Score: 438.728 bits (1127), Expect = 2.171e-122
Identity = 208/257 (80.93%), Postives = 228/257 (88.72%), Query Frame = 1
Query:   19 QIWLALSTLTLFFVSALADDVVVLTEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVPSNVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHKDGEEYGGGRYLEDFVSFINEKCGTSRDGKGQLTS 789
            QIW   + L L  VSA+ADDVVVLT+D+FEKEVG+D+GALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLI KVDCDE KS+C+KYGV GYPTIQWFPKGSLEP+KYEGPR+ EALAEYVN EGGTNVK+AAVP NVVVLT DNFDEIVLD++KDVLVEFYAPWCGHCK+LAPTYEKVA  F  E+ VV+ANLDAD +K L EKYGVSGFPTLKFFPK +K G +Y GGR L+DFVSFINEK GTSRD KGQLTS
Sbjct:    5 QIWFGFALLALLLVSAVADDVVVLTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIAKVDCDEQKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAEALAEYVNKEGGTNVKLAAVPQNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEGVVIANLDADAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFINEKSGTSRDSKGQLTS 261          
BLAST of EY659499 vs. ExPASy Swiss-Prot
Match: PDIA6_MEDSA (Probable protein disulfide-isomerase A6 OS=Medicago sativa PE=2 SV=1)

HSP 1 Score: 436.417 bits (1121), Expect = 1.078e-121
Identity = 209/265 (78.87%), Postives = 231/265 (87.17%), Query Frame = 1
Query:    7 IERYQIW----LALSTLTLFFVSALADDVVVLTEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVPSNVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHKDGEEYGGGRYLEDFVSFINEKCGTSRDGKGQLTS 789
            +E +QIW    LA     + FVS  ADDVVVLTE+NFEKEVG D+GALVEFYAPWCGHCKKLAPEYEKL  SFKKAKSVLI KVDCDEHKS+CSKYGV GYPTIQWFPKGSLEPKK+EGPR+ E+LAE+VN EGGTNVKIA  PS+VVVLT + F+E+VLD +KDVLVEFYAPWCGHCK+LAP YEKVAA F  EDDVV+ANLDADKY+DLAEKY VSGFPTLKFFPKG+K GE+YGGGR L+DFV+FINEK GTSRD KGQLTS
Sbjct:    3 MEMHQIWSRIALASFAFAILFVSVSADDVVVLTEENFEKEVGHDKGALVEFYAPWCGHCKKLAPEYEKLPNSFKKAKSVLIAKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKFEGPRTAESLAEFVNTEGGTNVKIATAPSHVVVLTPETFNEVVLDGTKDVLVEFYAPWCGHCKSLAPIYEKVAAVFKSEDDVVIANLDADKYRDLAEKYDVSGFPTLKFFPKGNKAGEDYGGGRDLDDFVAFINEKSGTSRDAKGQLTS 267          
BLAST of EY659499 vs. ExPASy Swiss-Prot
Match: PDI1_DICDI (Protein disulfide-isomerase 1 OS=Dictyostelium discoideum GN=pdi1 PE=1 SV=2)

HSP 1 Score: 258.07 bits (658), Expect = 5.253e-68
Identity = 134/262 (51.15%), Postives = 177/262 (67.56%), Query Frame = 1
Query:   19 QIWLALSTLTLFFVSALADD--VVVLTEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKS-VLIGKVDCDE--HKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVPSNVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDAD--KYKDLAEKYGVSGFPTLKFFPKGHKDGEEYGGGRYLEDFVSFINEKCGTSRDGKGQL 783
            +I L ++ + L FV+  + +  VVVL+ DNF+  V   +   V+FYAPWCGHCKKLAP++E L  +F    + V+I KVDCD+  +K+LCSKY V GYPT++ F K S   K Y G RS + L  Y+NN   TNVK+   PSNVV L+  NFD +VLDKSK+VLVEFYAPWCGHCK L P YE +   +A E DVV+A +D D    K +  KYGV+GFPTLK+F K  KDGE+Y  GR L+ F+++IN++ G +R   G+L
Sbjct:    2 KILLFVTLIALAFVALCSAEGNVVVLSPDNFDTVVDGSKTVFVKFYAPWCGHCKKLAPDFEILADTFAPVSNKVVIAKVDCDQADNKALCSKYDVSGYPTLKIFDK-STTAKDYNGARSVDELLTYINNHAKTNVKVKKAPSNVVDLSPSNFDSVVLDKSKNVLVEFYAPWCGHCKKLMPDYEILGNTYANEKDVVIAKIDCDAADNKAICSKYGVTGFPTLKWFGKQSKDGEKYEQGRDLDTFINYINKQAGVNRVKGGKL 262          
BLAST of EY659499 vs. ExPASy Swiss-Prot
Match: PDI2_SCHPO (Protein disulfide-isomerase C17H9.14c OS=Schizosaccharomyces pombe GN=SPAC17H9.14c PE=2 SV=1)

HSP 1 Score: 235.728 bits (600), Expect = 2.792e-61
Identity = 120/260 (46.15%), Postives = 160/260 (61.54%), Query Frame = 1
Query:   28 LALSTLTLFFVSAL--ADDVVVLTEDN-FEKEV-GQDRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVPSNVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHKDGEE-YGGGRYLEDFVSFINEKCGTSRDGKGQLTST 792
            L L +  +F + AL  A  VV L   N  E  +    +GAL+EFYA WCGHCK LAP YE+LGA F+    VLIGK+D D H  +  KY + G+PT+ WFP    EP +Y   R  ++L ++V+ + G   +   +PSNVV L + NFD++V+D  KDVLVEFYA WCG+CK LAPTYE +   F  E +V +  ++AD + D+   + V+ FPT+KFFPK  KD  E Y G R LE  + +IN+K GT R   G L ST
Sbjct:    3 LPLLSFVIFALFALVFASGVVELQSLNELENTIRASKKGALIEFYATWCGHCKSLAPVYEELGALFEDHNDVLIGKIDADTHSDVADKYHITGFPTLIWFPPDGSEPVQYSNARDVDSLTQFVSEKTGIKKRKIVLPSNVVELDSLNFDKVVMDDKKDVLVEFYADWCGYCKRLAPTYETLGKVFKNEPNVEIVKINADVFADIGRLHEVASFPTIKFFPKDDKDKPELYEGDRSLESLIEYINKKSGTQRSPDGTLLST 262          
BLAST of EY659499 vs. ExPASy Swiss-Prot
Match: TIGA_ASPNG (Protein disulfide-isomerase tigA OS=Aspergillus niger GN=tigA PE=2 SV=1)

HSP 1 Score: 217.624 bits (553), Expect = 7.867e-56
Identity = 120/250 (48.00%), Postives = 155/250 (62.00%), Query Frame = 1
Query:   49 LFFVSALADDVVVLTEDNFEKEVGQD-RGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKS-VLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVK-IAAVPSNVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDAD--KYKDLAEKYGVSGFPTLKFFPKGHKDGEEYGGGRYLEDFVSFINEKCGTSRDGKGQL 783
            L   SA+   VV L   NF+  V +  + ALVEF+APWCGHCK LAP YE+LG +F  A   V +GKVD DEH+ L  K+GVQG+PT++WF   S EP+ Y+G R  E+L+ +++ + G   +     PS V +L    F   V     DVLV F APWCGHCKNLAPT+E +A  F LE +VV+A +DAD    K  A + GVSG+PT+KFFPKG  +   Y G R  + F+ F+NEK GT R   G L
Sbjct:   11 LGLASAVTAAVVDLVPKNFDDVVLKSGKPALVEFFAPWCGHCKNLAPVYEELGQAFAHASDKVTVGKVDADEHRDLGRKFGVQGFPTLKWFDGKSDEPEDYKGGRDLESLSSFISEKTGVKPRGPKKEPSKVEMLNDATFKGAV-GGDNDVLVAFTAPWCGHCKNLAPTWEALANDFVLEPNVVIAKVDADAENGKATAREQGVSGYPTIKFFPKGSTESVPYEGARSEQAFIDFLNEKTGTHRTVGGGL 259          
BLAST of EY659499 vs. ExPASy Swiss-Prot
Match: ERP38_NEUCR (Protein disulfide-isomerase erp38 OS=Neurospora crassa GN=erp38 PE=2 SV=2)

HSP 1 Score: 207.994 bits (528), Expect = 6.234e-53
Identity = 111/255 (43.53%), Postives = 155/255 (60.78%), Query Frame = 1
Query:   31 ALSTLTLFFVSALADDVVVLTEDNFEKEVGQD-RGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKS-VLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVPSNVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDAD--KYKDLAEKYGVSGFPTLKFFPKGHKDGEEYGGGRYLEDFVSFINEKCGTSRDGKGQL 783
            +L   +L    A    V+ L   NF+  V +  +  LVEF+APWCGHCK LAP YE+L  + + AK  V I KVD D  ++L  ++GVQG+PT+++F   S +P  Y+G R  ++L+ ++  + G   +      ++V +  D   +  +   K+VLV F APWCGHCKNLAPT+EK+AA FA + ++ +A +DAD    K  A +YGVSGFPT+KFFPKG    E+Y GGR   D V F+NEK GT R   G L
Sbjct:    6 SLVVASLAAAVAAKSAVLDLIPSNFDDVVLKSGKPTLVEFFAPWCGHCKNLAPVYEELATALEYAKDKVQIAKVDADAERALGKRFGVQGFPTLKFFDGKSEQPVDYKGGRDLDSLSNFIAEKTGVKARKKGSAPSLVNILNDATIKGAIGGDKNVLVAFTAPWCGHCKNLAPTWEKLAATFASDPEITIAKVDADAPTGKKSAAEYGVSGFPTIKFFPKGSTTPEDYNGGRSEADLVKFLNEKAGTHRTPGGGL 260          

HSP 2 Score: 118.242 bits (295), Expect = 6.496e-26
Identity = 60/125 (48.00%), Postives = 77/125 (61.60%), Query Frame = 1
Query:  418 AVPSNVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFAL-EDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHKDGEEYGGGRYLEDFVSFINEKCGTSRDGKGQLTS 789
            A  S V+ L   NFD++VL   K  LVEF+APWCGHCKNLAP YE++A A    +D V +A +DAD  + L +++GV GFPTLKFF    +   +Y GGR L+   +FI EK G     KG   S
Sbjct:   17 AAKSAVLDLIPSNFDDVVLKSGKPTLVEFFAPWCGHCKNLAPVYEELATALEYAKDKVQIAKVDADAERALGKRFGVQGFPTLKFFDGKSEQPVDYKGGRDLDSLSNFIAEKTGVKARKKGSAPS 141          
BLAST of EY659499 vs. ExPASy Swiss-Prot
Match: PDIA6_RAT (Protein disulfide-isomerase A6 OS=Rattus norvegicus GN=Pdia6 PE=1 SV=2)

HSP 1 Score: 177.563 bits (449), Expect = 9.022e-44
Identity = 111/263 (42.21%), Postives = 151/263 (57.41%), Query Frame = 1
Query:   28 LALSTLTLFF-VSAL---ADDVVVLTEDNFEKEVGQ-DRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYV------------------NNEGGTNVKIAAVPSNVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDD----VVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHKDGEEYGGGRYLEDFVS 735
            L L + T F  VSAL   +DDV+ LT  NF +EV Q D   LVEFYAPWCGHC++L PE++K  ++ K    V +G V+ D+H+SL  +YGVQG+PTI+ F     +P+ Y+G R+ EA+ +                     + G      ++   +VV LT D FD+ VLD     +VEFYAPWCGHCKNL P  E  AAA  +++     V +A +DA   + LA +YG+ GFPT+K F KG +   +Y GGR   D VS
Sbjct:    6 LGLVSCTFFLAVSALYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAASALKDV--VKVGAVNADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRGDSSSKKDVVELTDDTFDKNVLDSEDVWMVEFYAPWCGHCKNLEP--EWAAAATEVKEQTKGKVKLAAVDATVNQVLASRYGIKGFPTIKIFQKG-ESPVDYDGGRTRSDIVS 263          
BLAST of EY659499 vs. ExPASy Swiss-Prot
Match: PDIA6_MOUSE (Protein disulfide-isomerase A6 OS=Mus musculus GN=Pdia6 PE=1 SV=3)

HSP 1 Score: 177.563 bits (449), Expect = 9.022e-44
Identity = 110/263 (41.83%), Postives = 149/263 (56.65%), Query Frame = 1
Query:   28 LALSTLTLFF-VSAL---ADDVVVLTEDNFEKEVGQDRGA-LVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYV------------------NNEGGTNVKIAAVPSNVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDD----VVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHKDGEEYGGGRYLEDFVS 735
            L L + T F  VS L   +DDV+ LT  NF +EV Q  G  LVEFYAPWCGHC++L PE++K   + K    V +G V+ D+H+SL  +YGVQG+PTI+ F     +P+ Y+G R+ EA+ +                     + G      ++   +VV LT D FD+ VLD     +VEFYAPWCGHCKNL P  E  AAA  +++     V +A +DA   + LA +YG+ GFPT+K F KG +   +Y GGR   D VS
Sbjct:    6 LGLVSCTFFLAVSGLYSSSDDVIELTPSNFNREVIQSDGLWLVEFYAPWCGHCQRLTPEWKKAATALKDV--VKVGAVNADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRGDSSSKKDVVELTDDTFDKNVLDSEDVWMVEFYAPWCGHCKNLEP--EWAAAATEVKEQTKGKVKLAAVDATVNQVLASRYGIKGFPTIKIFQKG-ESPVDYDGGRTRSDIVS 263          
BLAST of EY659499 vs. ExPASy Swiss-Prot
Match: PDIA6_PONAB (Protein disulfide-isomerase A6 OS=Pongo abelii GN=PDIA6 PE=2 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 2.625e-43
Identity = 103/245 (42.04%), Postives = 140/245 (57.14%), Query Frame = 1
Query:   70 ADDVVVLTEDNFEKEVGQ-DRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYV------------------NNEGGTNVKIAAVPSNVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDD----VVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHKDGEEYGGGRYLEDFVS 735
            +DDV+ LT  NF +EV Q D   LVEFYAPWCGHC++L PE++K   + K    V +G VD D+H SL  +YGVQG+PTI+ F      P+ Y+G R+ EA+ +                     + G      ++   +V+ LT D+FD+ VLD     +VEFYAPWCGHCKNL P  E  AAA  +++     V +A +DA   + LA +YG+ GFPT+K F KG +   +Y GGR   D VS
Sbjct:   24 SDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDV--VKVGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGQSGGYSSGKQGRSDSSSKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEP--EWAAAASEVKEQTKGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKG-ESPVDYDGGRTRSDIVS 263          

HSP 2 Score: 83.5741 bits (205), Expect = 1.773e-15
Identity = 43/103 (41.75%), Postives = 62/103 (60.19%), Query Frame = 1
Query:   61 SALADDVVVLTEDNFEKEVGQDRGA-LVEFYAPWCGHCKKLAPEYEKLGASFKKAK--SVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRS 360
            S+   DV+ LT+D+F+K V       +VEFYAPWCGHCK L PE+    +  K+     V +  VD   ++ L S+YG++G+PTI+ F KG   P  Y+G R+
Sbjct:  156 SSSKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGE-SPVDYDGGRT 257          
BLAST of EY659499 vs. ExPASy Swiss-Prot
Match: PDIA6_HUMAN (Protein disulfide-isomerase A6 OS=Homo sapiens GN=PDIA6 PE=1 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 2.625e-43
Identity = 103/245 (42.04%), Postives = 140/245 (57.14%), Query Frame = 1
Query:   70 ADDVVVLTEDNFEKEVGQ-DRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYV------------------NNEGGTNVKIAAVPSNVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDD----VVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHKDGEEYGGGRYLEDFVS 735
            +DDV+ LT  NF +EV Q D   LVEFYAPWCGHC++L PE++K   + K    V +G VD D+H SL  +YGVQG+PTI+ F      P+ Y+G R+ EA+ +                     + G      ++   +V+ LT D+FD+ VLD     +VEFYAPWCGHCKNL P  E  AAA  +++     V +A +DA   + LA +YG+ GFPT+K F KG +   +Y GGR   D VS
Sbjct:   24 SDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDV--VKVGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEP--EWAAAASEVKEQTKGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKG-ESPVDYDGGRTRSDIVS 263          

HSP 2 Score: 83.5741 bits (205), Expect = 1.773e-15
Identity = 43/103 (41.75%), Postives = 62/103 (60.19%), Query Frame = 1
Query:   61 SALADDVVVLTEDNFEKEVGQDRGA-LVEFYAPWCGHCKKLAPEYEKLGASFKKAK--SVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRS 360
            S+   DV+ LT+D+F+K V       +VEFYAPWCGHCK L PE+    +  K+     V +  VD   ++ L S+YG++G+PTI+ F KG   P  Y+G R+
Sbjct:  156 SSSKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGE-SPVDYDGGRT 257          
The following BLAST results are available for this feature:
BLAST of EY659499 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 87
Match NameE-valueIdentityDescription
PDIA6_ARATH2.171e-12280.93Probable protein disulfide-isomerase A6 OS=Arabido... [more]
PDIA6_MEDSA1.078e-12178.87Probable protein disulfide-isomerase A6 OS=Medicag... [more]
PDI1_DICDI5.253e-6851.15Protein disulfide-isomerase 1 OS=Dictyostelium dis... [more]
PDI2_SCHPO2.792e-6146.15Protein disulfide-isomerase C17H9.14c OS=Schizosac... [more]
TIGA_ASPNG7.867e-5648.00Protein disulfide-isomerase tigA OS=Aspergillus ni... [more]
ERP38_NEUCR6.234e-5343.53Protein disulfide-isomerase erp38 OS=Neurospora cr... [more]
PDIA6_RAT9.022e-4442.21Protein disulfide-isomerase A6 OS=Rattus norvegicu... [more]
PDIA6_MOUSE9.022e-4441.83Protein disulfide-isomerase A6 OS=Mus musculus GN=... [more]
PDIA6_PONAB2.625e-4342.04Protein disulfide-isomerase A6 OS=Pongo abelii GN=... [more]
PDIA6_HUMAN2.625e-4342.04Protein disulfide-isomerase A6 OS=Homo sapiens GN=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-009-G10-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659499 ID=EY659499|Name=EY659499|organism=Citrus sinensis|type=EST|length=922bp
ANAGATATTGAGAGGTATCAGATCTGGCTAGCTCTCAGCACTTTAACCTT
GTTCTTCGTATCAGCTCTAGCGGACGATGTCGTTGTGCTAACAGAAGACA
ACTTCGAGAAGGAGGTTGGTCAGGACAGGGGAGCTCTTGTTGAGTTTTAC
GCTCCTTGGTGTGGCCACTGTAAAAAGCTTGCTCCAGAGTATGAGAAACT
TGGTGCAAGCTTTAAGAAAGCAAAGTCTGTCTTGATTGGAAAGGTGGACT
GTGACGAGCATAAGAGCTTATGCAGCAAATATGGTGTTCAAGGATACCCA
ACAATTCAATGGTTTCCTAAAGGTTCTTTGGAACCCAAAAAGTATGAAGG
GCCACGATCTACTGAAGCCCTTGCTGAGTATGTGAATAATGAAGGAGGAA
CCAATGTGAAGATAGCTGCAGTCCCATCCAATGTGGTGGTACTAACAGCT
GATAATTTTGATGAGATAGTTTTGGACAAAAGCAAAGATGTTTTGGTTGA
ATTTTATGCACCATGGTGTGGCCATTGCAAAAACCTTGCGCCTACATATG
AAAAGGTGGCAGCCGCATTTGCATTGGAAGATGATGTAGTCGTTGCTAAT
TTGGATGCTGACAAATACAAGGATCTGGCTGAGAAGTATGGAGTTAGTGG
ATTTCCTACATTGAAGTTCTTTCCAAAAGGGCACAAAGATGGTGAGGAAT
ATGGGGGTGGCAGATATTTGGAAGACTTTGTTTCTTTCATCAATGAAAAA
TGTGGCACCAGTCGTGATGGAAAAGGACAACTTACTTCAACGGNGGTATA
GTTGCGAGCTTAAAGCCTNGGTGAAAGGATTTGTTGCTGCTACCGGTGAT
GAAAAAAGGCAGTCTTCTCAANATTGACCGGGAGTTTGAGTGCTTGAGGC
TCCACTGCGGCATGGGAAGATT
back to top