EY659492

Overview
NameEY659492
Unique NameEY659492
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length901
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659492 vs. ExPASy Swiss-Prot
Match: OSBL3_HUMAN (Oxysterol-binding protein-related protein 3 OS=Homo sapiens GN=OSBPL3 PE=1 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 6.283e-26
Identity = 74/193 (38.34%), Postives = 99/193 (51.30%), Query Frame = 3
Query:   69 TSSIYNLILGKXXWDHYGTXRIEGNREYSC--KLKFKEQSIFFRNPHHVHGVVQDRNGKTVATLFGKWDESIHYVIGECSGKGKELESLSEACLLWKRSKPPK-YATRYNFTRFAITLNEVTPGLKEKLPPTDSRLIPDQRCSENGEYEMANSDKLRLEQ----------------RPRHARKMQDNGWNQDG 590
            TS I+N++ G+   +HYG   I+   + SC  K+ F +   +  N H + G V DR+GK V  LFGKW ESI+     C G        S AC+ W+ +  PK Y   Y+FT+FA+ LNE+ P  K  LPPTD+R  PDQR  E G  E A   K R+EQ                +PR  RK  D+ W  +G
Sbjct:  687 TSCIHNILSGQRWIEHYGEIVIKNLHDDSCYCKVNFIKAKYWSTNAHEIEGTVFDRSGKAVHRLFGKWHESIY-----CGGGS------SSACV-WRANPMPKGYEQYYSFTQFALELNEMDPSSKSLLPPTDTRFRPDQRFLEEGNLEEAEIQKQRIEQLQRERRRVLEENHVEHQPRFFRKSDDDSWVSNG 867          
BLAST of EY659492 vs. ExPASy Swiss-Prot
Match: OSBL3_MOUSE (Oxysterol-binding protein-related protein 3 OS=Mus musculus GN=Osbpl3 PE=1 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 9.073e-25
Identity = 67/173 (38.73%), Postives = 96/173 (55.49%), Query Frame = 3
Query:   69 TSSIYNLILGKXXWDHYGTXRIEGNREYSC--KLKFKEQSIFFRNPHHVHGVVQDRNGKTVATLFGKWDESIHYVIGECSGKGKELESLSEACLLWKRSKPPK-YATRYNFTRFAITLNEVTPGLKEKLPPTDSRLIPDQRCSENGEYEMANSDKLRLEQRPRHARK-MQDNG 575
            TS I+N++ G+   +HYG   I+   + SC  K+ F +   +  N H + G V DR+GK V  LFGKW ESI+     C G        S +  +W+ +  PK Y   Y FT+FA+ LNE+ P  +  LPPTD+R  PDQR  E G+ E A   K R+E+  R  R+ +++NG
Sbjct:  655 TSCIHNILSGQRWIEHYGEIDIKNLNDDSCHCKVNFIKAKYWSTNAHEIEGTVFDRSGKAVHRLFGKWHESIY-----CGGA-------SSSTCVWRANPMPKGYEQYYGFTQFALELNEMDPLSRSLLPPTDTRFRPDQRLLEEGDIEEAEVQKQRIEKLQRERRRVLEENG 815          
BLAST of EY659492 vs. ExPASy Swiss-Prot
Match: OSBL6_HUMAN (Oxysterol-binding protein-related protein 6 OS=Homo sapiens GN=OSBPL6 PE=1 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 2.021e-24
Identity = 67/171 (39.18%), Postives = 92/171 (53.80%), Query Frame = 3
Query:   69 TSSIYNLILGKXXWDHYGTXRIEGNREYSC--KLKFKEQSIFFRNPHHVHGVVQDRNGKTVATLFGKWDESIHYVIGECSGKGKELESLSEACLLWKRSKPPKYATRYNFTRFAITLNEVTPGLKEKLPPTDSRLIPDQRCSENGEYEMANSDKLRLEQRPRHARK-MQDN 572
            T+ I+N++ G+   +HYG   I   +   C  KL F + + +  N + V GVV D+ GK V  LFGKW E ++  +             S  C+    S P  Y   Y FTRFAI LNE+ P LK+ LPPTD+R  PDQR  E G  E A S+K R+E+  R  R+ M++N
Sbjct:  730 TTCIHNILSGRRWIEHYGEVTIRNTKSSVCICKLTFVKVNYWNSNMNEVQGVVIDQEGKAVYRLFGKWHEGLYCGVAP-----------SAKCIWRPGSMPTNYELYYGFTRFAIELNELDPVLKDLLPPTDARFRPDQRFLEEGNLEAAASEKQRVEELQRSRRRYMEEN 889          
BLAST of EY659492 vs. ExPASy Swiss-Prot
Match: OSBL2_HUMAN (Oxysterol-binding protein-related protein 2 OS=Homo sapiens GN=OSBPL2 PE=1 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 5.881e-24
Identity = 66/200 (33.00%), Postives = 104/200 (52.00%), Query Frame = 3
Query:   69 TSSIYNLILGKXXWDHYGTXRIEGNRE-YSCKLKFKEQSIFFRNPHHVHGVVQDRNGKTVATLFGKWDESIHYV----------------------IGECSGKG------------KELESLSEACLLWK-RSKPPKYATRYNFTRFAITLNEVTPGLKEKLPPTDSRLIPDQRCSENGEYEMANSDKLRLEQRPRHARK 560
            T  ++N+I+GK   + YGT  I  +R  + C L FK   +F +  H V G +QD+N K +  ++GKW E +  +                      + E SGK             + ++ +  + LLW+  ++PP  A  YNFT F ++LNE+  G+++ LPPTD RL PD R  ENG  ++A+ +K RLE++ R AR+
Sbjct:  236 TCCVHNVIIGKLWIEQYGTVEILNHRTGHKCVLHFKPCGLFGKELHKVEGHIQDKNKKKLFMIYGKWTECLWGIDPVSYESFKKQERRGDHLRKAKLDEDSGKADSDVADDVPVAQETVQVIPGSKLLWRINTRPPNSAQMYNFTSFTVSLNELETGMEKTLPPTDCRLRPDIRGMENGNMDLASQEKERLEEKQREARR 435          
BLAST of EY659492 vs. ExPASy Swiss-Prot
Match: OSBL6_MOUSE (Oxysterol-binding protein-related protein 6 OS=Mus musculus GN=Osbpl6 PE=2 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 1.310e-23
Identity = 64/171 (37.43%), Postives = 92/171 (53.80%), Query Frame = 3
Query:   69 TSSIYNLILGKXXWDHYGTXRIEGNREYSC--KLKFKEQSIFFRNPHHVHGVVQDRNGKTVATLFGKWDESIHYVIGECSGKGKELESLSEACLLWKRSKPPKYATRYNFTRFAITLNEVTPGLKEKLPPTDSRLIPDQRCSENGEYEMANSDKLRLEQRPRHARK-MQDN 572
            T+ I+N++ G+   +HYG   +   +   C  KL F + + +  N + V GVV D+ GK V  LFGKW E ++  +             S  C+    S P  Y   Y FTRFA+ LNE+ P LK+ LPPTD+R  PDQR  E G  E A ++K R+E+  R  R+ M++N
Sbjct:  755 TTCIHNILSGRRWIEHYGEVTLRNTKSSVCICKLTFVKVNYWNSNVNEVQGVVIDQEGKVVHRLFGKWHEGLYCGVAP-----------SAKCIWRPGSLPTNYELYYGFTRFAVELNELDPVLKDLLPPTDARFRPDQRFLEEGNLEAAAAEKQRVEELQRSRRRYMEEN 914          
BLAST of EY659492 vs. ExPASy Swiss-Prot
Match: OSBL7_HUMAN (Oxysterol-binding protein-related protein 7 OS=Homo sapiens GN=OSBPL7 PE=2 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 4.978e-23
Identity = 62/169 (36.69%), Postives = 89/169 (52.66%), Query Frame = 3
Query:   69 TSSIYNLILGKXXWDHYGTXRIEGNREYSC--KLKFKEQSIFFRNPHHVHGVVQDRNGKTVATLFGKWDESIHYVIGECSGKGKELESLSEACLLWKRSKPPKYATRYNFTRFAITLNEVTPGLKEKLPPTDSRLIPDQRCSENGEYEMANSDKLRLEQRPRHARKMQD 569
            TS I+N++ G+   +HYG   I   ++ SC  K+ F +   +  N H V G V  R+G+ +  LFGKW E ++   G   G           C+    S PP +   + FT+FA+ LNE+T  LK  LP TD+RL PDQR  E G  + A + K R+EQ  R  RK+ +
Sbjct:  638 TSCIHNVLSGQRWIEHYGEVLIRNTQDSSCHCKITFCKAKYWSSNVHEVQGAVLSRSGRVLHRLFGKWHEGLYR--GPTPGG---------QCIWKPNSMPPDHERNFGFTQFALELNELTAELKRSLPSTDTRLRPDQRYLEEGNIQAAEAQKRRIEQLQRDRRKVME 795          
BLAST of EY659492 vs. ExPASy Swiss-Prot
Match: OSBL2_MOUSE (Oxysterol-binding protein-related protein 2 OS=Mus musculus GN=Osbpl2 PE=2 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 4.215e-22
Identity = 66/204 (32.35%), Postives = 101/204 (49.51%), Query Frame = 3
Query:   69 TSSIYNLILGKXXWDHYGTXRIEGNREYS-CKLKFKEQSIFFRNPHHVHGVVQDRNGKTVATLFGKWDESIHYVI-------------GECSGKGK-------------------------ELESLSEACLLWK-RSKPPKYATRYNFTRFAITLNEVTPGLKEKLPPTDSRLIPDQRCSENGEYEMANSDKLRLEQRPRHARK 560
            T  ++N+ILG+   + YG   I  +R    C L FK   +F +  H V G +QD+N K +  ++GKW E +  +              G+ + K K                          ++ +  + LLW+  S+PP  A  YNFT F ++LNE+  G+++ LPPTD RL PD R  ENG  ++A+ +K RLE++ R ARK
Sbjct:  236 TCCVHNVILGQLWIEQYGIVEIVNHRTGDKCILHFKPCGLFGKELHRVEGYIQDKNRKKLFIMYGKWTECLWGIDPASYESFKKQEKRGDQARKAKMDDGPEKANSDVPGDVADDVPVAQETVQVIPGSKLLWRINSRPPNSAQMYNFTSFTVSLNELESGMEKTLPPTDCRLRPDIRGMENGNMDLASQEKERLEEKQREARK 439          
BLAST of EY659492 vs. ExPASy Swiss-Prot
Match: YB35_SCHPO (Oxysterol-binding protein homolog C2F12.05c OS=Schizosaccharomyces pombe GN=SPBC2F12.05c PE=1 SV=2)

HSP 1 Score: 104.76 bits (260), Expect = 7.189e-22
Identity = 66/171 (38.60%), Postives = 93/171 (54.39%), Query Frame = 3
Query:   69 TSSIYNLILGKXXWDHYGTXRIEGNRE-YSCKLKFKEQSIFFRNPHHVHGVVQDRNGKTVATLFGKWDESIHYVIGECSGKGKELESLSEACLLWKR-SKPPKYATRYNFTRFAITLNEVTPGLKEKLPPTDSRLIPDQRCSENGEYEMANSDKLRLEQRPRHARKMQDNG 575
            TSS+  +ILG    D+YG   I  +    +C L FK +     N H V G VQ  +      + G W++ I    G+     K         LLW+   +PP+    +N T FAI+LN +TP LK  LPPTD+RL PDQR  ENG+Y++A S+K RLE++ R  R+M++ G
Sbjct: 1099 TSSVVGIILGSPSVDNYGQMHIVNHSSGINCVLDFKPRGWRGTNAHEVKGSVQSTDDTPKWMVNGHWNDKI---FGQQPNGNK--------ILLWQNHERPPR---PFNLTPFAISLNALTPQLKPWLPPTDTRLRPDQRAMENGQYDLAASEKNRLEEKQRKKRRMREQG 1255          
BLAST of EY659492 vs. ExPASy Swiss-Prot
Match: OSBL1_MOUSE (Oxysterol-binding protein-related protein 1 OS=Mus musculus GN=Osbpl1a PE=1 SV=2)

HSP 1 Score: 104.375 bits (259), Expect = 9.389e-22
Identity = 66/197 (33.50%), Postives = 97/197 (49.24%), Query Frame = 3
Query:   69 TSSIYNLILGKXXWDHYGTXRIEGNREYS-CKLKFKEQSIFFRNPHHVHGVVQDRNGKTVATLFGKWDESIHYVIG--------------ECSGKGKELESLSEA-----------------CLLWKRS-KPPKYATRYNFTRFAITLNEVTPGLKEKLPPTDSRLIPDQRCSENGEYEMANSDKLRLEQRPRHARK 560
            T  ++N+I+GK   + YG   I  ++    C L FK   +F +  H V G +QD++ K +  L+GKW E ++ V                E     K+  S  E+                  LLW+ + +PP  A  YNFT FA+ LNEV   ++  +P TD RL PD R  ENGE ++A+ +K RLE++ R ARK
Sbjct:  709 TCCVHNIIVGKLWIEQYGNVEIINHKTGDKCVLNFKPCGLFGKELHKVEGYIQDKSKKKLCALYGKWTECLYSVDPATFDAYKKNDKKNTEEKKNSKQTSSSEESDEMPVPDSESVFIIPGSVLLWRIAPRPPNSAQMYNFTSFAMVLNEVDKEMESVIPKTDCRLRPDIRAMENGEIDLASEEKKRLEEKQRAARK 905          
BLAST of EY659492 vs. ExPASy Swiss-Prot
Match: OSBL1_HUMAN (Oxysterol-binding protein-related protein 1 OS=Homo sapiens GN=OSBPL1A PE=1 SV=2)

HSP 1 Score: 103.99 bits (258), Expect = 1.226e-21
Identity = 65/197 (32.99%), Postives = 97/197 (49.24%), Query Frame = 3
Query:   69 TSSIYNLILGKXXWDHYGTXRIEGNREYS-CKLKFKEQSIFFRNPHHVHGVVQDRNGKTVATLFGKWDESIHYVIG--------------ECSGKGKELESLSE-----------------ACLLWKRS-KPPKYATRYNFTRFAITLNEVTPGLKEKLPPTDSRLIPDQRCSENGEYEMANSDKLRLEQRPRHARK 560
            T  ++N+I+GK   + YG   I  ++    C L FK   +F +  H V G +QD++ K +  L+GKW E ++ V                E     K++ +  E                 + LLW+ + +PP  A  YNFT FA+ LNEV   ++  +P TD RL PD R  ENGE + A+ +K RLE++ R ARK
Sbjct:  709 TCCVHNIIVGKLWIEQYGNVEIINHKTGDKCVLNFKPCGLFGKELHKVEGYIQDKSKKKLCALYGKWTECLYSVDPATFDAYKKNDKKNTEEKKNSKQMSTSEELDEMPVPDSESVFIIPGSVLLWRIAPRPPNSAQMYNFTSFAMVLNEVDKDMESVIPKTDCRLRPDIRAMENGEIDQASEEKKRLEEKQRAARK 905          
The following BLAST results are available for this feature:
BLAST of EY659492 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 19
Match NameE-valueIdentityDescription
OSBL3_HUMAN6.283e-2638.34Oxysterol-binding protein-related protein 3 OS=Hom... [more]
OSBL3_MOUSE9.073e-2538.73Oxysterol-binding protein-related protein 3 OS=Mus... [more]
OSBL6_HUMAN2.021e-2439.18Oxysterol-binding protein-related protein 6 OS=Hom... [more]
OSBL2_HUMAN5.881e-2433.00Oxysterol-binding protein-related protein 2 OS=Hom... [more]
OSBL6_MOUSE1.310e-2337.43Oxysterol-binding protein-related protein 6 OS=Mus... [more]
OSBL7_HUMAN4.978e-2336.69Oxysterol-binding protein-related protein 7 OS=Hom... [more]
OSBL2_MOUSE4.215e-2232.35Oxysterol-binding protein-related protein 2 OS=Mus... [more]
YB35_SCHPO7.189e-2238.60Oxysterol-binding protein homolog C2F12.05c OS=Sch... [more]
OSBL1_MOUSE9.389e-2233.50Oxysterol-binding protein-related protein 1 OS=Mus... [more]
OSBL1_HUMAN1.226e-2132.99Oxysterol-binding protein-related protein 1 OS=Hom... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-009-G03-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659492 ID=EY659492|Name=EY659492|organism=Citrus sinensis|type=EST|length=901bp
CATGACCTACCCATGCGAACGAAACTTTGGTCCTTGATGATGGTTTTTTT
TAACAACCGAGTNAGGNTACCTCATCAATCTATAATCTCATATTGGGAAA
GNTGNACTGGGATCACTATGGTACANTGCGTATAGAGGGAAATCGTGAGT
ACTCGTGTAAGCTGAAATTCAAAGAGCAGTCTATTTTTTTTAGAAATCCA
CATCACGTCCATGGCGTAGTTCAAGACAGGAATGGAAAAACAGTGGCAAC
CCTATTTGGAAAATGGGATGAGAGCATCCATTACGTGATTGGAGAATGTT
CTGGAAAGGGAAAAGAACTTGAGTCTTTATCAGAAGCTTGCCTGCTCTGG
AAGCGGAGCAAGCCTCCCAAATATGCCACCAGATATAACTTCACTCGTTT
TGCCATCACATTGAATGAAGTCACCCCTGGTCTGAAGGAAAAGTTGCCTC
CAACAGATTCGAGGCTCATACCTGACCAAAGGTGTTCGGAAAATGGGGAG
TATGAGATGGCAAATTCAGATAAGTTGCGGCTTGAGCAGCGACCACGGCA
TGCTCGGAAGATGCAAGATAATGGCTGGAACCAAGATGGTTTGCAAAGAT
AGGGCGACCGGGACATATCGCTTCATTGGCCGGTTCTGGGAACCGAGAGA
ACAGGAGATTGAACTTATGGCCTGATTTATTGGGCATATCCCTTCTGATC
AAATGTTGGACTGGAGTTACATATTTTCGGCTTGGTTTCCCCACTCCTTT
GAACCATTTTTCTTTTTACCTTGGGTGGGGCCCCTGAGGACCTGGTTTGA
AAACCGGCCAGGGGGAGTGTCCCCATTTTTTCCTGTACGAATATTTAAGA
AAAAAATGTGTTGTTCCTCTTCTTCATAAAATAAATAAAAAGAGCGGCCG
T
back to top