EY659353

Overview
NameEY659353
Unique NameEY659353
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length481
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY659353_ssr162 microsatellite EY659353_ssr162:162..173. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7710 contig Csv1_Contig7710:839..1319. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659353 vs. ExPASy Swiss-Prot
Match: THF1_ARATH (Protein THYLAKOID FORMATION 1, chloroplastic OS=Arabidopsis thaliana GN=THF1 PE=1 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 8.595e-16
Identity = 41/78 (52.56%), Postives = 50/78 (64.10%), Query Frame = 2
Query:   11 ANATEPTVLEKLCAVLNVNKRSVDRDLDVYRNXXXXXXXXXXXXXEYVDXXXXXXXXXTEPQKANEAIKKCLGEYLYS 244
            A+AT+PTVL+KLCA LN+NK+SVDRDLDVYRN             EYV+          + QKANE I KCLG+ LY+
Sbjct:  214 ASATDPTVLDKLCASLNINKKSVDRDLDVYRNLLSKLVQAKELLKEYVEREKKKQGERAQSQKANETISKCLGDTLYN 291          
BLAST of EY659353 vs. ExPASy Swiss-Prot
Match: THF1_SOLTU (Protein THYLAKOID FORMATION1, chloroplastic OS=Solanum tuberosum GN=THF1 PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 1.466e-15
Identity = 42/78 (53.85%), Postives = 49/78 (62.82%), Query Frame = 2
Query:   11 ANATEPTVLEKLCAVLNVNKRSVDRDLDVYRNXXXXXXXXXXXXXEYVDXXXXXXXXXTEPQKANEAIKKCLGEYLYS 244
            AN T+PT+LEKLCA LNVNK+SVDRDLDVYRN             EYV+          E QKANE + KCLG+Y Y+
Sbjct:  215 ANVTDPTILEKLCAALNVNKKSVDRDLDVYRNLLSKLVQAKELLKEYVE-REKKKRGERETQKANETVTKCLGDYQYA 291          
BLAST of EY659353 vs. ExPASy Swiss-Prot
Match: THF1_ORYSJ (Protein THYLAKOID FORMATION1, chloroplastic OS=Oryza sativa subsp. japonica GN=THF1 PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 3.057e-13
Identity = 37/70 (52.86%), Postives = 44/70 (62.86%), Query Frame = 2
Query:   11 ANATEPTVLEKLCAVLNVNKRSVDRDLDVYRNXXXXXXXXXXXXXEYVDXXXXXXXXXTEPQKANEAIKK 220
            ANATEPT+L+KLCA LN+NKRSVDRDLDVYRN             EYV+         +E  K+NEA+ K
Sbjct:  208 ANATEPTILDKLCAALNINKRSVDRDLDVYRNILSKLVQAKELLKEYVEREKKKREERSETPKSNEAVTK 277          
The following BLAST results are available for this feature:
BLAST of EY659353 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
THF1_ARATH8.595e-1652.56Protein THYLAKOID FORMATION 1, chloroplastic OS=Ar... [more]
THF1_SOLTU1.466e-1553.85Protein THYLAKOID FORMATION1, chloroplastic OS=Sol... [more]
THF1_ORYSJ3.057e-1352.86Protein THYLAKOID FORMATION1, chloroplastic OS=Ory... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-C02-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659353 ID=EY659353|Name=EY659353|organism=Citrus sinensis|type=EST|length=481bp
CCACGCGTCCGCAAATGCAACTGAACCCACAGTGTTAGAAAAGCTTTGTG
CAGTCTTAAATGTTAACAAAAGAAGTGTGGATCGTGACCTTGATGTATAT
CGCAATTTATTATCCAAGCTGCTTCAAGCTAAAGAGTTGCTGAAGGAGTA
TGTGGATAGGGAGAAGAAGAAGAGAGAAGAAAGGACAGAACCGCAAAAGG
CTAATGAAGCCATTAAAAAATGTCTGGGAGAATACCTATATTCCCATCAG
TAATTCAACCTGTGAAGGAAGCCGGCAATGCTAATCATCTCTTGTGAAGT
TTCCATCCCGTTTTTGTCTGCTTTGTGGTAGAGTTGGAGCCTCAATGCTC
CATGTACCATGTTTTAAGCTTACAGGCTTGCATGTTTCAGTGTACTGTTT
TTAATACGGTGATTTACATACATCCAGTCTTCACCATGCTAATACACAAA
TTTCTTCTGTTTTAAAAAAAAAAAAAAAAAA
back to top