EY659345

Overview
NameEY659345
Unique NameEY659345
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length925
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig610 contig Csv1_Contig610:258..1182. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659345 vs. ExPASy Swiss-Prot
Match: SUC2_ARATH (Sucrose transport protein SUC2 OS=Arabidopsis thaliana GN=SUC2 PE=1 SV=2)

HSP 1 Score: 293.123 bits (749), Expect = 1.481e-78
Identity = 164/304 (53.95%), Postives = 190/304 (62.50%), Query Frame = 1
Query:   13 ISGMIVQPIVGFHSDTCKSRFGRRRPXXXXXXXXXXXXXXXXXYAADIGHSAGDSVTDSVKTRAIIIFVIGFWILDVANNTLQGPCRALLADLSGSSNKKTRTANSFFSFFMAVGNVLGYAAGSYTHLYHMLPFTKSKACDVYCANLKTCXXXXXXXXXXXXXXXXXYVTEQRLEEIDDKETAPSTKDPFFSEIFGALKGLQKPMWILLAVTALNWIAWFPFLVFDTDWMXEGGVXREL*GQCKGA-----------EGV*QRGESGVXGADAYAIVLGFTSLGVESWRTDCCVRALGRGISGA 891
            ISGM+VQPIVG+HSD C SRFGRRRP                 YAADIGHS GD +    KTRAI IF +GFWILDVANNTLQGPCRA LADLS  + KKTRTAN+FFSFFMAVGNVLGYAAGSY +LY ++PFT +++CD+YCANLKTC                 YV E+     +      ++  PFF EIFGA K L++PMW+LL VTALNWIAWFPFL+FDTDWM      RE+ G    A           +GV     +G  G    AIVLGF SLGVE W        +GR + GA
Sbjct:   76 ISGMLVQPIVGYHSDRCTSRFGRRRPFIVAGAGLVTVAVFLIGYAADIGHSMGDQLDKPPKTRAIAIFALGFWILDVANNTLQGPCRAFLADLSAGNAKKTRTANAFFSFFMAVGNVLGYAAGSYRNLYKVVPFTMTESCDLYCANLKTCFFLSITLLLIVTFVSLCYVKEKPWTP-EPTADGKASNVPFFGEIFGAFKELKRPMWMLLIVTALNWIAWFPFLLFDTDWM-----GREVYGGNSDATATAASKKLYNDGV----RAGALGLMLNAIVLGFMSLGVE-W--------IGRKLGGA 360          
BLAST of EY659345 vs. ExPASy Swiss-Prot
Match: SUC1_ARATH (Sucrose transport protein SUC1 OS=Arabidopsis thaliana GN=SUC1 PE=1 SV=1)

HSP 1 Score: 292.352 bits (747), Expect = 2.527e-78
Identity = 157/297 (52.86%), Postives = 186/297 (62.63%), Query Frame = 1
Query:   13 ISGMIVQPIVGFHSDTCKSRFGRRRPXXXXXXXXXXXXXXXXXYAADIGHSAGDSVTDSVKTRAIIIFVIGFWILDVANNTLQGPCRALLADLSGSSNKKTRTANSFFSFFMAVGNVLGYAAGSYTHLYHMLPFTKSKACDVYCANLKTCXXXXXXXXXXXXXXXXXYVTEQRL----EEIDDKETAPSTKDPFFSEIFGALKGLQKPMWILLAVTALNWIAWFPFLVFDTDWMXEGGVXREL*GQCKGAEGV*QRGESGVXGADAYAIVLGFTSLGVESWRTDCCVRALGRGISGA 891
            +SGMIVQPIVGFHSD C+S+FGRRRP                 YAAD G+  GD + + VK RAI IF +GFWILDVANNTLQGPCRA LADL+    K+TR AN+FFSFFMAVGNVLGYAAGSYT+L+ M PFT +KACD+YCANLKTC                 YV +++        DD E   S   P F EIFGA K +++PMW+LL VTALNWIAWFPFL+FDTDWM       +  G  +  +      +SG  G    +IVLGF SLGVE W        +GR + GA
Sbjct:   77 VSGMIVQPIVGFHSDRCRSKFGRRRPFIATGAALVAVAVFLIGYAADFGYKMGDKLEEKVKVRAIGIFALGFWILDVANNTLQGPCRAFLADLAAGDAKRTRVANAFFSFFMAVGNVLGYAAGSYTNLHKMFPFTMTKACDIYCANLKTCFFLSITLLLIVTVTSLWYVNDKQWSPPPRNADDDEKTSSV--PLFGEIFGAFKVMKRPMWMLLIVTALNWIAWFPFLLFDTDWMGREVFGGDSDGNERSKKLYSLGVQSGAMGLMFNSIVLGFMSLGVE-W--------IGRKLGGA 362          
BLAST of EY659345 vs. ExPASy Swiss-Prot
Match: SUC6_ARATH (Putative sucrose transport protein SUC6 OS=Arabidopsis thaliana GN=SUC6 PE=5 SV=2)

HSP 1 Score: 291.967 bits (746), Expect = 3.300e-78
Identity = 149/275 (54.18%), Postives = 179/275 (65.09%), Query Frame = 1
Query:   13 ISGMIVQPIVGFHSDTCKSRFGRRRPXXXXXXXXXXXXXXXXXYAADIGHSAGDSVTDSVKTRAIIIFVIGFWILDVANNTLQGPCRALLADLSGSSNKKTRTANSFFSFFMAVGNVLGYAAGSYTHLYHMLPFTKSKACDVYCANLKTCXXXXXXXXXXXXXXXXXYVTEQRLEEIDDKETAPSTKDPFFSEIFGALKGLQKPMWILLAVTALNWIAWFPFLVFDTDWMXEGGVXREL*GQCKGAEGV*QRGESGVXGADAYAIVLGFTSLGVE 837
            +SG++VQP VG+ SD CKSRFGRRRP                 YAAD GHS GD V + VK RA++IF +GFWILDVANNTLQGPCRA L DL+    KKTRTAN+FFSFFMAVGNVLGYAAGSYT+LY + PFT +KACD+YCANLK+C                 YV +   ++   K  + + K PFF EIFGA K +++PMW+LL VTALNWIAWFPFL++DTDWM       +  G  K  +   Q    G  G    +IVLGF SLG+E
Sbjct:   77 VSGLLVQPSVGYFSDRCKSRFGRRRPFIAMGALLVAVAVVLIGYAADFGHSMGDKVDEPVKMRAVVIFALGFWILDVANNTLQGPCRAFLGDLAAGDAKKTRTANAFFSFFMAVGNVLGYAAGSYTNLYKIFPFTMTKACDIYCANLKSCFFLSITLLLVVTIIALWYVED---KQWSPKADSDNEKTPFFGEIFGAFKVMKRPMWMLLIVTALNWIAWFPFLLYDTDWMGREVYGGDSKGDDKMKKLYNQGIHVGGLGLMLNSIVLGFMSLGIE 348          
BLAST of EY659345 vs. ExPASy Swiss-Prot
Match: SUC8_ARATH (Sucrose transport protein SUC8 OS=Arabidopsis thaliana GN=SUC8 PE=1 SV=1)

HSP 1 Score: 287.345 bits (734), Expect = 8.127e-77
Identity = 146/275 (53.09%), Postives = 176/275 (64.00%), Query Frame = 1
Query:   13 ISGMIVQPIVGFHSDTCKSRFGRRRPXXXXXXXXXXXXXXXXXYAADIGHSAGDSVTDSVKTRAIIIFVIGFWILDVANNTLQGPCRALLADLSGSSNKKTRTANSFFSFFMAVGNVLGYAAGSYTHLYHMLPFTKSKACDVYCANLKTCXXXXXXXXXXXXXXXXXYVTEQRLEEIDDKETAPSTKDPFFSEIFGALKGLQKPMWILLAVTALNWIAWFPFLVFDTDWMXEGGVXREL*GQCKGAEGV*QRGESGVXGADAYAIVLGFTSLGVE 837
            +SG++VQP VG+ SD C SRFGRRRP                 YAAD GHS GD +   VK RA++IF +GFWILDVANNTLQGPCRA L DL+    KKTRTAN+FFSFFMAVGNVLGYAAGSYT+LY + PFT +KACD+YCANLK+C                 YV +   ++   K  + + K PFF EIFGA K +++PMW+LL VTALNWIAWFPFL++DTDWM       +  G  K  +   Q    G  G    +IVLG  SLG+E
Sbjct:   77 VSGLLVQPSVGYFSDRCTSRFGRRRPFIATGALLVAVAVVLIGYAADFGHSMGDKIDKPVKMRAVVIFALGFWILDVANNTLQGPCRAFLGDLAAGDAKKTRTANAFFSFFMAVGNVLGYAAGSYTNLYKIFPFTMTKACDIYCANLKSCFFLSITLLLVVTIIALWYVED---KQWSPKADSDNEKTPFFGEIFGAFKVMKRPMWMLLIVTALNWIAWFPFLLYDTDWMGREVYGGDSKGDDKMKKLYNQGIHVGALGLMLNSIVLGIVSLGIE 348          
BLAST of EY659345 vs. ExPASy Swiss-Prot
Match: SUC7_ARATH (Putative sucrose transport protein SUC7 OS=Arabidopsis thaliana GN=SUC7 PE=5 SV=2)

HSP 1 Score: 285.034 bits (728), Expect = 4.034e-76
Identity = 145/275 (52.73%), Postives = 176/275 (64.00%), Query Frame = 1
Query:   13 ISGMIVQPIVGFHSDTCKSRFGRRRPXXXXXXXXXXXXXXXXXYAADIGHSAGDSVTDSVKTRAIIIFVIGFWILDVANNTLQGPCRALLADLSGSSNKKTRTANSFFSFFMAVGNVLGYAAGSYTHLYHMLPFTKSKACDVYCANLKTCXXXXXXXXXXXXXXXXXYVTEQRLEEIDDKETAPSTKDPFFSEIFGALKGLQKPMWILLAVTALNWIAWFPFLVFDTDWMXEGGVXREL*GQCKGAEGV*QRGESGVXGADAYAIVLGFTSLGVE 837
            +SG++VQP VG+ SD C SRFGRRRP                 YAAD GHS GD +   VK RA++IF +GFWILDVANNTLQGPCRA L DL+    +KTRTAN+FFSFFMAVGNVLGYAAGSYT+LY + PFT +KACD+YCANLK+C                 YV +   ++   K  + + K PFF EIFGA K +++PMW+LL VTALNWIAWFPFL++DTDWM       +  G  K  +   Q    G  G    +IVLG  SLG+E
Sbjct:   76 VSGLLVQPSVGYFSDRCTSRFGRRRPFIATGALLVAVSVVLIGYAADFGHSMGDKIDKPVKMRAVVIFALGFWILDVANNTLQGPCRAFLGDLAAGDAQKTRTANAFFSFFMAVGNVLGYAAGSYTNLYKIFPFTMTKACDIYCANLKSCFFLSITLLLVVTIIALWYVED---KQWSPKADSDNEKTPFFGEIFGAFKVMKRPMWMLLIVTALNWIAWFPFLLYDTDWMGREVYGGDSKGDDKMKKLYNQGIHVGALGLMLNSIVLGVMSLGIE 347          
BLAST of EY659345 vs. ExPASy Swiss-Prot
Match: SUC5_ARATH (Sucrose transport protein SUC5 OS=Arabidopsis thaliana GN=SUC5 PE=1 SV=1)

HSP 1 Score: 283.108 bits (723), Expect = 1.533e-75
Identity = 148/293 (50.51%), Postives = 186/293 (63.48%), Query Frame = 1
Query:   13 ISGMIVQPIVGFHSDTCKSRFGRRRPXXXXXXXXXXXXXXXXXYAADIGHSAGDSVTDSVKTRAIIIFVIGFWILDVANNTLQGPCRALLADLSGSSNKKTRTANSFFSFFMAVGNVLGYAAGSYTHLYHMLPFTKSKACDVYCANLKTCXXXXXXXXXXXXXXXXXYVTEQRLEEIDDKETAPSTKDPFFSEIFGALKGLQKPMWILLAVTALNWIAWFPFLVFDTDWMXEGGVXREL*GQCKGAEGV*QRGESGVXGADAYAIVLGFTSLGVESWRTDCCVRALGRGISGA 891
            ISGMIVQPIVG+HSD C+SRFGRRRP                 +AAD+GHS GD + + V+TRAIIIF+ GFW LDVANNTLQGPCRA LADL+    KKTR AN+ FSFFMAVGNVLGYAAGSYT+L+ M PFT +KACD+YCANLKTC                 YV +++       +   ++   FF EIFGA++ +++PM +LL VT +NWIAWFPF+++DTDWM          G  +  +   Q  ++G  G    +I+LGF SLGVES         +GR + GA
Sbjct:   78 ISGMIVQPIVGYHSDRCESRFGRRRPFIAAGVALVAVSVFLIGFAADMGHSFGDKLENKVRTRAIIIFLTGFWFLDVANNTLQGPCRAFLADLAAGDAKKTRVANACFSFFMAVGNVLGYAAGSYTNLHKMFPFTMTKACDIYCANLKTCFFLSITLLLIVTFSSLWYVKDKQWSPPQGDKEEKTSSLFFFGEIFGAVRHMKRPMVMLLIVTVINWIAWFPFILYDTDWMGREVYGGNSDGDERSKKLYDQGVQAGALGLMFNSILLGFVSLGVES---------IGRKMGGA 361          
BLAST of EY659345 vs. ExPASy Swiss-Prot
Match: SUC9_ARATH (Sucrose transport protein SUC9 OS=Arabidopsis thaliana GN=SUC9 PE=1 SV=1)

HSP 1 Score: 275.789 bits (704), Expect = 2.447e-73
Identity = 142/272 (52.21%), Postives = 175/272 (64.34%), Query Frame = 1
Query:   13 ISGMIVQPIVGFHSDTCKSRFGRRRPXXXXXXXXXXXXXXXXXYAADIGHSAGDSVTDSVKTRAIIIFVIGFWILDVANNTLQGPCRALLADLSGSSNKKTRTANSFFSFFMAVGNVLGYAAGSYTHLYHMLPFTKSKACDVYCANLKTCXXXXXXXXXXXXXXXXXYVTEQRLEEIDDKETAPSTKDPFFSEIFGALKGLQKPMWILLAVTALNWIAWFPFLVFDTDWMXEGGVXREL*GQCKGAEGV*QRGESGVXGADAYAIVLGFTSL 828
            ISG++VQP VG+ SD CKSRFGRRRP                 +AAD GH+ GD + ++VK RA+  FV+GFWILDVANNTLQGPCRA L DL+    KKTRTAN+ FSFFMAVGNVLGYAAGSYT+L+ + PFT +KACD+YCANLK+C                 YV +++     D +   + K PFF EIFGA K +++PMW+LLAVTALNWIAWFPFL++DTDWM       +  G  K  +      + G  G    +IVLG  SL
Sbjct:   77 ISGLLVQPTVGYFSDRCKSRFGRRRPFIATGALLVALAVILIGFAADFGHTMGDKLDEAVKIRAVGFFVVGFWILDVANNTLQGPCRAFLGDLAAGDAKKTRTANAIFSFFMAVGNVLGYAAGSYTNLHKIFPFTVTKACDIYCANLKSCFIISITLLIVLTIIALWYVEDKQWSPNADSD---NEKTPFFGEIFGAFKVMKRPMWMLLAVTALNWIAWFPFLLYDTDWMGREVYGGDSAGDDKMKKLYNHGIQVGSLGLMLNSIVLGVMSL 345          
BLAST of EY659345 vs. ExPASy Swiss-Prot
Match: SUT_SPIOL (Sucrose transport protein OS=Spinacia oleracea PE=2 SV=1)

HSP 1 Score: 270.011 bits (689), Expect = 1.343e-71
Identity = 145/285 (50.88%), Postives = 182/285 (63.86%), Query Frame = 1
Query:   13 ISGMIVQPIVGFHSDTCKSRFGRRRPXXXXXXXXXXXXXXXXXYAADIGHSAGDSVTDSVKTRAIIIFVIGFWILDVANNTLQGPCRALLADLSGSSNKKTRTANSFFSFFMAVGNVLGYAAGSYTHLYHMLPFTKSKACDVYCANLKTCXXXXXXXXXXXXXXXXXYVTEQR--LEEIDDKETAPSTKD-------PFFSEIFGALKGLQKPMWILLAVTALNWIAWFPFLVFDTDWMXEGGVXREL*GQCKGAEGV*QRG-ESGVXGADAYAIVLGFTSLGVE 837
            ISGMIVQP+VG++SD C SRFGRRRP                 +AADIG ++GD   +  K RAI +FV+GFWILDVANNTLQGPCRALLAD++  S  KTR AN+FFSFFMA+GN+ GYAAGSY+ LY + PFTK+ ACDVYCANLK+C                  V E++  ++EI ++E   +  +       PFF ++ GALK L KPM ILL VTALNWIAWFPFL+FDTDWM      +E+ G   G   +  +G  +G  G    ++VLG  SL +E
Sbjct:   82 ISGMIVQPLVGYYSDRCTSRFGRRRPFIAAGAALVAVAVGLIGFAADIGAASGDPTGNVAKPRAIAVFVVGFWILDVANNTLQGPCRALLADMAAGSQTKTRYANAFFSFFMALGNIGGYAAGSYSRLYTVFPFTKTAACDVYCANLKSCFFISITLLIVLTILALSVVKERQITIDEIQEEEDLKNRNNSSGCARLPFFGQLIGALKDLPKPMLILLLVTALNWIAWFPFLLFDTDWM-----GKEVYGGTVGEGKLYDQGVHAGALGLMINSVVLGVMSLSIE 361          
BLAST of EY659345 vs. ExPASy Swiss-Prot
Match: SUC4_ARATH (Sucrose transport protein SUC4 OS=Arabidopsis thaliana GN=SUC4 PE=1 SV=2)

HSP 1 Score: 216.083 bits (549), Expect = 2.301e-55
Identity = 125/291 (42.96%), Postives = 159/291 (54.64%), Query Frame = 1
Query:   13 ISGMIVQPIVGFHSDTCKSRFGRRRPXXXXXXXXXXXXXXXXXYAADIGHSAGDSVTDSVKTRAIIIFVIGFWILDVANNTLQGPCRALLADLSGSSNKKTRTANSFFSFFMAVGNVLGYAAGSYTHLYHMLPFTKSKACDVYCANLKTCXXXXXXXXXXXXXXXXXYVTEQRLEEIDDKE--TAPSTKDPFFSEIFGALKGLQKPMWILLAVTALNWIAWFPFLVFDTDWMXEGGVXREL*GQCKGAEGV*QRGESGVXGADAYAIVLGFTSLGVESWRTDCCVRALGRG 879
            +SG+ VQP+VG  SD C S++GRRRP                 +AADIG + GD     +K RAI+ FV+GFWILDVANN  QGPCRALLADL+ + N++TR AN +FS FMAVGNVLGYA GSY   Y +  FTK+ AC+V CANLK+                     E  L  +  +       T + F SEIFG  +     +WI+L VTAL WI WFPF++FDTDWM      RE+ G   G   +     +GV    A  ++L    LG+ S   +   R  G G
Sbjct:   87 LSGLFVQPLVGHSSDRCTSKYGRRRPFIVAGAVAISISVMVIGHAADIGWAFGDR-EGKIKPRAIVAFVLGFWILDVANNMTQGPCRALLADLTENDNRRTRVANGYFSLFMAVGNVLGYATGSYNGWYKIFTFTKTVACNVECANLKSAFYIDVVFIAITTILSVSAAHEVPLASLASEAHGQTSGTDEAFLSEIFGTFRYFPGNVWIILLVTALTWIGWFPFILFDTDWM-----GREIYG---GEPNIGTSYSAGV-SMGALGLMLNSVFLGITSVLMEKLCRKWGAG 367          
BLAST of EY659345 vs. ExPASy Swiss-Prot
Match: SUT2_ORYSJ (Sucrose transport protein 2 OS=Oryza sativa subsp. japonica GN=SUT2 PE=2 SV=2)

HSP 1 Score: 200.675 bits (509), Expect = 1.000e-50
Identity = 109/283 (38.52%), Postives = 159/283 (56.18%), Query Frame = 1
Query:   13 ISGMIVQPIVGFHSDT---CKSRFGRRRPXXXXXXXXXXXXXXXXXYAADIGHSAGDSVTD-SVKTRAIIIFVIGFWILDVANNTLQGPCRALLADLSGSSNKKTRTANSFFSFFMAVGNVLGYAAGSYTHLYHMLPFTKSKACDVYCANLKTCXXXXXXXXXXXXXXXXXYVTEQRLEEIDDKETAPSTKDPFFSEIFGALKGLQKPMWILLAVTALNWIAWFPFLVFDTDWMXEGGVXREL*GQCKGAEGV*QRGESGV----XGADAYAIVLGFTSLGVE 837
            +SG++VQP+VG  SD      S  GRRRP                 ++AD+G   GDS+T  S +  AII++++GFW+LDV NN  QGPCRA LADL+ +  ++TR AN++FS FMA+GN+LGYA G+Y+  Y + PFT + +C + CANLK+                   V E +    D+ +   + ++ F  E+FG+ +    P+W++L VTAL WI WFPF++FDTDWM      RE+         + Q    GV     G    +++LGFTS+ +E
Sbjct:   71 LSGLLVQPLVGHLSDRIAPAASPLGRRRPFIAAGAASIAAAVLTVGFSADLGRIFGDSITPGSTRLGAIIVYLVGFWLLDVGNNATQGPCRAFLADLTENDPRRTRIANAYFSLFMALGNILGYATGAYSGWYKIFPFTVTPSCSISCANLKSAFLLDIIILVVTTCITVASVQEPQSFGSDEADHPSTEQEAFLWELFGSFRYFTLPVWMVLIVTALTWIGWFPFILFDTDWM-----GREIYRGSPDDPSITQSYHDGVRMGSFGLMLNSVLLGFTSIVLE 348          
The following BLAST results are available for this feature:
BLAST of EY659345 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 13
Match NameE-valueIdentityDescription
SUC2_ARATH1.481e-7853.95Sucrose transport protein SUC2 OS=Arabidopsis thal... [more]
SUC1_ARATH2.527e-7852.86Sucrose transport protein SUC1 OS=Arabidopsis thal... [more]
SUC6_ARATH3.300e-7854.18Putative sucrose transport protein SUC6 OS=Arabido... [more]
SUC8_ARATH8.127e-7753.09Sucrose transport protein SUC8 OS=Arabidopsis thal... [more]
SUC7_ARATH4.034e-7652.73Putative sucrose transport protein SUC7 OS=Arabido... [more]
SUC5_ARATH1.533e-7550.51Sucrose transport protein SUC5 OS=Arabidopsis thal... [more]
SUC9_ARATH2.447e-7352.21Sucrose transport protein SUC9 OS=Arabidopsis thal... [more]
SUT_SPIOL1.343e-7150.88Sucrose transport protein OS=Spinacia oleracea PE=... [more]
SUC4_ARATH2.301e-5542.96Sucrose transport protein SUC4 OS=Arabidopsis thal... [more]
SUT2_ORYSJ1.000e-5038.52Sucrose transport protein 2 OS=Oryza sativa subsp.... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-B06-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659345 ID=EY659345|Name=EY659345|organism=Citrus sinensis|type=EST|length=925bp
CCACGCGTCCGCATCTCCGGCATGATCGTCCAGCCCATCGTCGGCTTCCA
CAGCGACACCTGCAAATCCCGCTTCGGCCGTCGCCGCCCCTTCATTCTCG
CCGGCGCCGTCCTCGTCGCCATCGCTGTGTTTCTCATCGGCTACGCCGCC
GACATAGGCCACTCCGCGGGCGACTCCGTTACCGATTCCGTCAAAACCCG
CGCCATCATCATCTTCGTCATCGGCTTCTGGATTCTCGACGTTGCGAATA
ACACATTACAAGGCCCATGCAGAGCCCTCCTCGCCGATCTCTCCGGCAGC
AGCAACAAGAAAACAAGAACCGCAAACTCTTTTTTCTCCTTCTTCATGGC
CGTCGGTAACGTGCTTGGCTATGCCGCCGGCTCCTACACTCACTTGTACC
ACATGCTTCCGTTCACAAAGTCAAAAGCTTGCGACGTTTACTGTGCAAAT
TTGAAAACGTGCTTCTTCCTCTCCATAGCTCTGCTAATAACCCTAACGAC
AATAGCACTGTTTTACGTAACTGAGCAAAGATTAGAAGAGATTGATGATA
AAGAAACGGCGCCGTCCACGAAGGATCCATTTTTCAGCGAGATATTTGGT
GCATTGAAAGGGTTGCAAAAGCCTATGTGGATCCTACTTGCGGTGACAGC
GTTGAACTGGATTGCATGGTTCCCGTTCTTGGTGTTCGACACTGATTGGA
TGGNNGAGGGAGGTGTACNGAGGGAACTCTAAGGNCAGTGCAAAGGAGCT
GAGGGTGTATAACAACGGGGTGAGAGCGGGGTCNTTGGGGCTGATGCTTA
CGCTATCGTTCTGGGGTTCACGTCCCTGGGTGTGGAGTCTTGGCGAACTG
ATTGTTGCGTCAGAGCTCTTGGGCGTGGCATTTCTGGTGCGGTTCTTTGC
TTCCCTTTTGATACAAATGCCGAGC
back to top