EY659344

Overview
NameEY659344
Unique NameEY659344
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length928
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY659344_ssr583 microsatellite EY659344_ssr583:583..594. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of EY659344 vs. ExPASy Swiss-Prot
Match: IFRH_SOLTU (Isoflavone reductase homolog OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 279.256 bits (713), Expect = 2.225e-74
Identity = 134/178 (75.28%), Postives = 156/178 (87.64%), Query Frame = 2
Query:    8 SAKAKIRRAVEAEGIPYTYVASNFFAAYFLPNLSQPGATAPPRDKVVILGDGNPKAVYNKEDDIGTYTIKAVDDPRTLNKILYIKPPGNIYSFNDLVSLWERKIGKTLQRVYVPEEQVLKNIQEAAPPVNVILSIQHSAFVKGDQTNFQIEPSFGVEASQLYPDVKYTTVDEYLSQFV 541
            + KA+IRR VEAEGIP+TYVA+ FFA Y LPNL+QPGA  PP DKVVILG GN KAV+NKE+DIGTYTI AVDDP+TLNKILYIKPP NI + N+LVSLWE+K GK L+R+YVPEEQVLKNIQEA+ P+NV LSI H+AFVKGD TNF+IEPSFGVEAS++YPDVKYT +DE L+Q+V
Sbjct:  131 NTKAQIRRVVEAEGIPFTYVATFFFAGYSLPNLAQPGAAGPPNDKVVILGHGNTKAVFNKEEDIGTYTINAVDDPKTLNKILYIKPPHNIITLNELVSLWEKKTGKNLERLYVPEEQVLKNIQEASVPMNVGLSIYHTAFVKGDHTNFEIEPSFGVEASEVYPDVKYTPIDEILNQYV 308          
BLAST of EY659344 vs. ExPASy Swiss-Prot
Match: IFRH_ARATH (Isoflavone reductase homolog P3 OS=Arabidopsis thaliana GN=At1g75280 PE=1 SV=1)

HSP 1 Score: 249.98 bits (637), Expect = 1.445e-65
Identity = 121/179 (67.60%), Postives = 145/179 (81.01%), Query Frame = 2
Query:    8 SAKAKIRRAVEAEGIPYTYVASNFFAAYFLPNLSQ--PGATAPPRDKVVILGDGNPKAVYNKEDDIGTYTIKAVDDPRTLNKILYIKPPGNIYSFNDLVSLWERKIGKTLQRVYVPEEQVLKNIQEAAPPVNVILSIQHSAFVKGDQTNFQIEPSFGVEASQLYPDVKYTTVDEYLSQF 538
            + K +IRR +EAEGIPYTY  +  F  Y+LP L Q  PG T+PPRDKV ILGDGN KAV NKE+DI  YTIKAVDDPRTLNKILYIKP  N  S N++V+LWE+KIGK+L++ ++PEEQ+LK+IQE+  P+NV+LSI H+ FV GD TN  IEPSFGVEAS+LYPDVKYT+VDEYLS F
Sbjct:  132 AGKIQIRRTIEAEGIPYTYAVTGCFGGYYLPTLVQFEPGLTSPPRDKVTILGDGNAKAVINKEEDIAAYTIKAVDDPRTLNKILYIKPSNNTLSMNEIVTLWEKKIGKSLEKTHLPEEQLLKSIQESPIPINVVLSINHAVFVNGD-TNISIEPSFGVEASELYPDVKYTSVDEYLSYF 309          
BLAST of EY659344 vs. ExPASy Swiss-Prot
Match: IFRH_TOBAC (Isoflavone reductase homolog A622 OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 240.35 bits (612), Expect = 1.145e-62
Identity = 112/176 (63.64%), Postives = 141/176 (80.11%), Query Frame = 2
Query:   14 KAKIRRAVEAEGIPYTYVASNFFAAYFLPNLSQPGATAPPRDKVVILGDGNPKAVYNKEDDIGTYTIKAVDDPRTLNKILYIKPPGNIYSFNDLVSLWERKIGKTLQRVYVPEEQVLKNIQEAAPPVNVILSIQHSAFVKGDQTNFQIEPSFGVEASQLYPDVKYTTVDEYLSQFV 541
            K +IRR +EAEGIPYTYV  N+FA +FLPNL Q  A  PPRDKVVI GDGNPKA+Y KE+DI TYTI+AVDDPRTLNK L+++PP NI SFN++VSLWE KIGKTL+++Y+ EE +L+ +QE   P+   L+I HS FV GD  NF+++P  GVEA++LYP VKYTTVDE+ ++FV
Sbjct:  135 KVRIRRMIEAEGIPYTYVICNWFADFFLPNLGQLEAKTPPRDKVVIFGDGNPKAIYVKEEDIATYTIEAVDDPRTLNKTLHMRPPANILSFNEIVSLWEDKIGKTLEKLYLSEEDILQIVQEGPLPLRTNLAICHSVFVNGDSANFEVQPPTGVEATELYPKVKYTTVDEFYNKFV 310          
BLAST of EY659344 vs. ExPASy Swiss-Prot
Match: IFRH_MAIZE (Isoflavone reductase homolog IRL OS=Zea mays GN=IRL PE=2 SV=1)

HSP 1 Score: 231.876 bits (590), Expect = 4.074e-60
Identity = 110/177 (62.15%), Postives = 138/177 (77.97%), Query Frame = 2
Query:   11 AKAKIRRAVEAEGIPYTYVASNFFAAYFLPNLSQPGATAPPRDKVVILGDGNPKAVYNKEDDIGTYTIKAVDDPRTLNKILYIKPPGNIYSFNDLVSLWERKIGKTLQRVYVPEEQVLKNIQEAAPPVNVILSIQHSAFVKGDQTNFQIEPSFGVEASQLYPDVKYTTVDEYLSQFV 541
            AK  IRRA EA GIPYTY  + FFA + LP + Q  A  PP DK V+LGDG+ KAV+ +E DI TYT+ A DDPR  NK+LYIKPP N  S N+L+SLWE+K GKT +R YVPEE VLK IQE+  P+N+IL+I H+AFV+G+QT F+I+P+ GV+AS+LYPDVKYTTVDEYL++F+
Sbjct:  133 AKVGIRRATEAAGIPYTYAVAGFFAGFGLPKVGQVLAPGPPADKAVVLGDGDTKAVFVEEGDIATYTVLAADDPRAENKVLYIKPPANTLSHNELLSLWEKKTGKTFRREYVPEEAVLKQIQESPIPLNIILAIGHAAFVRGEQTGFEIDPAKGVDASELYPDVKYTTVDEYLNRFL 309          
BLAST of EY659344 vs. ExPASy Swiss-Prot
Match: IFR_MEDSA (Isoflavone reductase OS=Medicago sativa GN=IFR PE=1 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 1.269e-53
Identity = 100/176 (56.82%), Postives = 134/176 (76.14%), Query Frame = 2
Query:   14 KAKIRRAVEAEGIPYTYVASNFFAAYFLPNLSQPGATAPPRDKVVILGDGNPKAVYNKEDDIGTYTIKAVDDPRTLNKILYIKPPGNIYSFNDLVSLWERKIGKTLQRVYVPEEQVLKNIQEAAPPVNVILSIQHSAFVKGDQTNFQIEPSFGVEASQLYPDVKYTTVDEYLSQFV 541
            KA IRR +EAEG+PYTY+  + F  YFL NL+Q   T PPRDKVVILGDGN K  Y  E D+GT+TI+A +DP TLNK ++I+ P N  + N++++LWE+KIGKTL++ YV EEQVLK+IQE++ P N +L++ HS  +KGD   ++I+P+  +EAS+ YPDV YTT DEYL+QFV
Sbjct:  144 KASIRRVIEAEGVPYTYLCCHAFTGYFLRNLAQLDTTDPPRDKVVILGDGNVKGAYVTEADVGTFTIRAANDPNTLNKAVHIRLPENYLTQNEVIALWEKKIGKTLEKTYVSEEQVLKDIQESSFPHNYLLALYHSQQIKGDAV-YEIDPAKDIEASEAYPDVTYTTADEYLNQFV 318          
BLAST of EY659344 vs. ExPASy Swiss-Prot
Match: IFR_PEA (Isoflavone reductase OS=Pisum sativum GN=IFR PE=2 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 1.658e-53
Identity = 101/176 (57.39%), Postives = 133/176 (75.57%), Query Frame = 2
Query:   14 KAKIRRAVEAEGIPYTYVASNFFAAYFLPNLSQPGATAPPRDKVVILGDGNPKAVYNKEDDIGTYTIKAVDDPRTLNKILYIKPPGNIYSFNDLVSLWERKIGKTLQRVYVPEEQVLKNIQEAAPPVNVILSIQHSAFVKGDQTNFQIEPSFGVEASQLYPDVKYTTVDEYLSQFV 541
            KA IRR VE+EG+PYTY+  + F  YFL NL+Q  AT PPRDKVVILGDGN +  Y  E D+GTYTI+A +DP TLNK ++I+ P N  + N++++LWE+KIGKTL++ YV EEQVLK+IQ ++ P N +L++ HS  +KGD   ++I+P+  VEA   YPDVKYTT DEYL+QFV
Sbjct:  144 KASIRRVVESEGVPYTYLCCHAFTGYFLRNLAQIDATDPPRDKVVILGDGNVRGAYVTEADVGTYTIRAANDPNTLNKAVHIRLPNNYLTANEVIALWEKKIGKTLEKTYVSEEQVLKDIQTSSFPHNYLLALYHSQQIKGDAV-YEIDPAKDVEAYDAYPDVKYTTADEYLNQFV 318          
BLAST of EY659344 vs. ExPASy Swiss-Prot
Match: IFR_CICAR (Isoflavone reductase OS=Cicer arietinum GN=IFR PE=1 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 2.828e-53
Identity = 102/176 (57.95%), Postives = 131/176 (74.43%), Query Frame = 2
Query:   14 KAKIRRAVEAEGIPYTYVASNFFAAYFLPNLSQPGATAPPRDKVVILGDGNPKAVYNKEDDIGTYTIKAVDDPRTLNKILYIKPPGNIYSFNDLVSLWERKIGKTLQRVYVPEEQVLKNIQEAAPPVNVILSIQHSAFVKGDQTNFQIEPSFGVEASQLYPDVKYTTVDEYLSQFV 541
            KA IRR VEAEG+PYTY+  + F  YFL NL+Q  AT PPRDKV+ILGDGN K  Y  E D+GTYTI+A +DPRTLNK ++I+ P N  + N++VSLWE+KIGKTL++ Y+ EE+VLK+I  +  P N +L++ HS  +KGD   ++I+P+   EA  LYPDVKYTT DEYL QFV
Sbjct:  144 KASIRRVVEAEGVPYTYLCCHAFTGYFLRNLAQFDATEPPRDKVIILGDGNVKGAYVTEADVGTYTIRAANDPRTLNKAVHIRLPHNYLTSNEVVSLWEKKIGKTLEKSYISEEKVLKDINVSTFPHNYLLALYHSQQIKGDAV-YEIDPAKDAEAYDLYPDVKYTTADEYLDQFV 318          
BLAST of EY659344 vs. ExPASy Swiss-Prot
Match: IFRH_LUPAL (Isoflavone reductase homolog OS=Lupinus albus PE=2 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 6.116e-40
Identity = 81/176 (46.02%), Postives = 114/176 (64.77%), Query Frame = 2
Query:   14 KAKIRRAVEAEGIPYTYVASNFFAAYFLPNLSQPGATAPPRDKVVILGDGNPKAVYNKEDDIGTYTIKAVDDPRTLNKILYIKPPGNIYSFNDLVSLWERKIGKTLQRVYVPEEQVLKNIQEAAPPVNVILSIQHSAFVKGDQTNFQIEPSFGVEASQLYPDVKYTTVDEYLSQFV 541
            K  +R+A+E   IP+TY+++N FA YF  NLSQ     PPRDKV++ GDGN K VY  EDD+ TYTIK +DDPRTLNK +Y++PP NI +  +L+  WE  IGK L++  + E+  L  ++       V +   +  F +G  TNF+I  + G EAS+LYP+V YT +D+YL  +V
Sbjct:  138 KMTVRKAIEEANIPFTYISANCFAGYFAGNLSQMKTLLPPRDKVLLYGDGNVKPVYMDEDDVATYTIKTIDDPRTLNKTVYLRPPENILTHKELIEKWEELIGKQLEKNSISEKDFLSTLKGLDFASQVGVGHFYHIFYEGCLTNFEIGEN-GEEASELYPEVNYTRMDQYLKVYV 312          
BLAST of EY659344 vs. ExPASy Swiss-Prot
Match: IGS1_PETHY (Isoeugenol synthase 1 OS=Petunia hybrida GN=IGS1 PE=1 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 1.506e-38
Identity = 80/172 (46.51%), Postives = 112/172 (65.12%), Query Frame = 2
Query:   14 KAKIRRAVEAEGIPYTYVASNFFAAYFLPNLSQPGATAPPRDKVVILGDGNPKAVYNKEDDIGTYTIKAVDDPRTLNKILYIKPPGNIYSFNDLVSLWERKIGKTLQRVYVPEEQVLKNIQEAAPPVNVILSIQHSAFVKGDQTNFQIEPSFGVEASQLYPDVKYTTVDEYL 529
            K KIRRA EA GIP+T+V++N   AYF+  L  P   +   ++V I G G+ KAV N E+D+  YTIKA DDPR  N++L IKPP NI S  DLVS WE+  G TL+  ++ E++++K  +    P N+  SI H+ F+ G Q +F++     +EAS+LYP+  YT+VDEYL
Sbjct:  135 KKKIRRATEAAGIPFTFVSANSLTAYFVDYLLHPRQKS---EQVTIYGSGDAKAVLNYEEDVAAYTIKAADDPRAANRVLIIKPPKNIVSQLDLVSSWEKTTGSTLKMTHISEQEIIKLSESINFPENIHASILHNIFIAGAQLSFELTQDHDLEASELYPNYNYTSVDEYL 303          
BLAST of EY659344 vs. ExPASy Swiss-Prot
Match: EGS1_OCIBA (Eugenol synthase 1 OS=Ocimum basilicum GN=EGS1 PE=1 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 2.405e-36
Identity = 75/176 (42.61%), Postives = 113/176 (64.20%), Query Frame = 2
Query:   14 KAKIRRAVEAEGIPYTYVASNFFAAYFLPNLSQPGATAPPRDKVVILGDGNPKAVYNKEDDIGTYTIKAVDDPRTLNKILYIKPPGNIYSFNDLVSLWERKIGKTLQRVYVPEEQVLKNIQEAAPPVNVILSIQHSAFVKGDQTNFQIEPSFGVEASQLYPDVKYTTVDEYLSQFV 541
            K  IRRA+E   IPYTYV++N FA+YF+  L +P     P+D++ + G G  K   N E DIG YTIK   DPR LN+++  +P  NI +  +L+S WE+KIGK  ++++VPEE+++   +E   P N+ ++I H  F+ G   ++  + +  VEAS LYP++K+TT+DE L  FV
Sbjct:  132 KRMIRRAIEEANIPYTYVSANCFASYFINYLLRP---YDPKDEITVYGTGEAKFAMNYEQDIGLYTIKVATDPRALNRVVIYRPSTNIITQLELISRWEKKIGKKFKKIHVPEEEIVALTKELPEPENIPIAILHCLFIDGATMSYDFKEN-DVEASTLYPELKFTTIDELLDIFV 303          
The following BLAST results are available for this feature:
BLAST of EY659344 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
IFRH_SOLTU2.225e-7475.28Isoflavone reductase homolog OS=Solanum tuberosum ... [more]
IFRH_ARATH1.445e-6567.60Isoflavone reductase homolog P3 OS=Arabidopsis tha... [more]
IFRH_TOBAC1.145e-6263.64Isoflavone reductase homolog A622 OS=Nicotiana tab... [more]
IFRH_MAIZE4.074e-6062.15Isoflavone reductase homolog IRL OS=Zea mays GN=IR... [more]
IFR_MEDSA1.269e-5356.82Isoflavone reductase OS=Medicago sativa GN=IFR PE=... [more]
IFR_PEA1.658e-5357.39Isoflavone reductase OS=Pisum sativum GN=IFR PE=2 ... [more]
IFR_CICAR2.828e-5357.95Isoflavone reductase OS=Cicer arietinum GN=IFR PE=... [more]
IFRH_LUPAL6.116e-4046.02Isoflavone reductase homolog OS=Lupinus albus PE=2... [more]
IGS1_PETHY1.506e-3846.51Isoeugenol synthase 1 OS=Petunia hybrida GN=IGS1 P... [more]
EGS1_OCIBA2.405e-3642.61Eugenol synthase 1 OS=Ocimum basilicum GN=EGS1 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-B05-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659344 ID=EY659344|Name=EY659344|organism=Citrus sinensis|type=EST|length=928bp
CCACGCGTCCGCAAAGGCAAAAATCCGCCGAGCCGTTGAGGCTGAAGGGA
TTCCGTATACTTATGTAGCGTCGAATTTCTTTGCTGCTTACTTCCTTCCC
AATTTGTCGCAGCCCGGGGCCACTGCCCCACCTAGGGATAAAGTTGTCAT
CTTAGGCGATGGAAATCCAAAAGCTGTTTATAACAAGGAAGATGATATTG
GAACCTATACTATCAAAGCGGTTGATGATCCCAGAACCTTGAACAAAATC
CTTTACATTAAACCCCCTGGTAATATTTACTCATTCAATGATCTTGTGTC
CTTGTGGGAGAGAAAGATTGGCAAAACCCTCCAAAGGGTGTACGTTCCGG
AGGAGCAAGTCCTAAAGAATATTCAAGAAGCTGCACCTCCAGTCAATGTG
ATATTATCAATTCAGCACTCTGCTTTCGTGAAGGGAGATCAAACCAACTT
CCAGATTGAACCATCGTTTGGAGTTGAAGCCTCGCAGCTCTATCCTGATG
TCAAGTACACTACAGTTGATGAGTATCTCAGTCAGTTTGTGTAAACCCTT
CTCTGTTGAGCTGCAGCTTGCAGGATCTTGGGAAATAAATAAATAATTGG
CTTTTTGCCATCTTTGGTTTCTATATGTAAGCATTATGGTTGTTGGCCTT
ACTTTCGTTTGTTTCTCAATGTGTAGTTTGTAATTAACACCATATTGTGT
CGACTATGTCNGTACACAGTGATCAAATAAAGTAGCCCCATGTGATTAAA
AANAAAAAAAAAAAAAAAANNANNNANNNANNNNNNNNNNNANNNNNNNA
AAAAGGGCGGCGCTCTAAAGAATCAAGTTTACGACGCGGCTTGGGACGCA
TAACTCTTCATAAGGACCCAAATTAATCCCTGGGCGGCGTTTAAACGCGG
GAATGGAAAACCGGGGTACCAACTATCC
back to top