EY659278

Overview
NameEY659278
Unique NameEY659278
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length919
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7012 contig Csv1_Contig7012:158..1076. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659278 vs. ExPASy Swiss-Prot
Match: KSG8_ARATH (Shaggy-related protein kinase theta OS=Arabidopsis thaliana GN=ASK8 PE=2 SV=3)

HSP 1 Score: 317.39 bits (812), Expect = 7.257e-86
Identity = 173/298 (58.05%), Postives = 207/298 (69.46%), Query Frame = 1
Query:    1 MRRLNSIASGRTXXXXXXXXXXXXKRAKVDKELE-VNGEANLVERSASSLEQHMASTSLEPVASTSEAATVARTERSGFDQLPKEMNEMRIRDEKNVNHDDKDLEPSIVNGNGTEAGQVIATTVGGRNGQPKQTISYMAERVVGTGSFGVVFQAKCLETGDSVAIKNVLXG*RYKNRELQIMRLLNHPNVVSLKHCFFSTTEKDELYLNPVLEYISETVYRVS*HYTRMNXHVPILYVQLYTYQICRALKLLHHVGGGGSFETLATKFIGHPHTHQLKNVTFEVPKCLCQVNPT*RYL 891
            MRRL SIASGRT            KRAK+D+E + +  +   V++++S  E      S E VA TS    V+  E+   DQLP  M EM+IRDE+N N +DKD+E ++VNG+GTE GQVI TTVGGR+G+PKQTISYMA+RVVGTGSFGVVFQAKCLETG+ VAIK VL   RYKNRELQIMRL +HPNVV L+H FFSTT+KDELYLN VLEY+ ETVYR S HYT+MN H+PI++VQLYTYQICRAL  LH V G    +      + +P THQLK   F   K L    P   Y+
Sbjct:    4 MRRLKSIASGRTSISSDPGGDYALKRAKLDQENDNLCVDPMQVDQNSSCFEMKADVLSQESVAGTSNVPAVS--EKPVDDQLPDVMIEMKIRDERNANREDKDMETTVVNGSGTETGQVITTTVGGRDGKPKQTISYMAQRVVGTGSFGVVFQAKCLETGEQVAIKKVLQDKRYKNRELQIMRLQDHPNVVRLRHSFFSTTDKDELYLNLVLEYVPETVYRASKHYTKMNQHMPIIFVQLYTYQICRALNYLHRVVGVCHRDIKPQNLLVNPQTHQLKICDFGSAKMLVPGEPNISYI 299          
BLAST of EY659278 vs. ExPASy Swiss-Prot
Match: KSGT_BRANA (Shaggy-related protein kinase theta OS=Brassica napus PE=2 SV=2)

HSP 1 Score: 292.738 bits (748), Expect = 1.914e-78
Identity = 166/304 (54.61%), Postives = 197/304 (64.80%), Query Frame = 1
Query:    1 MRRLNSIASGRTXXXXXXXXXXXXKRAKVDKELEVNGEANLVERSASSLE----QHMASTSLEPVASTSEAATVARTERSGFDQLPKEMNEMRIRDEK---NVNHDDKDLEPSIVNGNGTEAGQVIATTVGGRNGQPKQTISYMAERVVGTGSFGVVFQAKCLETGDSVAIKNVLXG*RYKNRELQIMRLLNHPNVVSLKHCFFSTTEKDELYLNPVLEYISETVYRVS*HYTRMNXHVPILYVQLYTYQICRALKLLHHVGGGGSFETLATKFIGHPHTHQLKNVTFEVPKCLCQVNPT*RYL 891
            MRRL SIASGRT            KR K+D++ +     NL  R    ++      M   S + VA TS             DQLP+ MN+MR+R+++   N   +DKD+EP IVNG GTE GQVI TTVGGR+G+PKQTISYMA+RVVGTGSFGVVFQAKCLETG+ VAIK VL   RYKNRELQIMRL +HPNVV L+H FFSTT+KDELYLN VLE++ ETVYR   HYT+MN H+PI+ VQLYTYQICRAL  LH V G    +      + + HTHQLK   F   K L    P   Y+
Sbjct:    4 MRRLKSIASGRTSISSDPGVDSSLKRPKLDQDND-----NLSSRGDDPMQVDQSTDMVVVSQDTVAGTSNVPPPP-------DQLPEVMNDMRLREDEPHANRGEEDKDMEPPIVNGCGTETGQVITTTVGGRDGKPKQTISYMAQRVVGTGSFGVVFQAKCLETGEQVAIKKVLQDKRYKNRELQIMRLQDHPNVVRLRHSFFSTTDKDELYLNLVLEFVPETVYRALKHYTKMNQHMPIILVQLYTYQICRALNYLHRVVGVCHRDIKPQNLLVNTHTHQLKICDFGSAKMLVPGEPNISYI 295          
BLAST of EY659278 vs. ExPASy Swiss-Prot
Match: KSG1_ARATH (Shaggy-related protein kinase alpha OS=Arabidopsis thaliana GN=ASK1 PE=2 SV=3)

HSP 1 Score: 275.018 bits (702), Expect = 4.130e-73
Identity = 140/237 (59.07%), Postives = 172/237 (72.57%), Query Frame = 1
Query:  181 VASTSEAATVARTERSGFDQLPKEMNEMRIRDEKNVNHDDKDLEPSIVNGNGTEAGQVIATTVGGRNGQPKQTISYMAERVVGTGSFGVVFQAKCLETGDSVAIKNVLXG*RYKNRELQIMRLLNHPNVVSLKHCFFSTTEKDELYLNPVLEYISETVYRVS*HYTRMNXHVPILYVQLYTYQICRALKLLHHVGGGGSFETLATKFIGHPHTHQLKNVTFEVPKCLCQVNPT*RYL 891
            +AS   A      + +G D+LP+EMN+M+IRD       DK++E ++V+GNGTE G +I TT+GGRNGQPKQTISYMAERVVG GSFGVVFQAKCLETG++VAIK VL   RYKNRELQ MRLL+HPNVVSLKHCFFSTTEKDELYLN VLEY+ ETV+RV  HY ++N  +P++YV+LYTYQI RAL  +H   G    +      + +PHTHQ+K   F   K L +  P   Y+
Sbjct:    1 MASVGIAPNPGARDSTGVDKLPEEMNDMKIRD-------DKEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPETVHRVIKHYNKLNQRMPLIYVKLYTYQIFRALSYIHRCIGVCHRDIKPQNLLVNPHTHQVKLCDFGSAKVLVKGEPNISYI 230          
BLAST of EY659278 vs. ExPASy Swiss-Prot
Match: MSK1_TOBAC (Shaggy-related protein kinase NtK-1 OS=Nicotiana tabacum GN=NTK-1 PE=2 SV=1)

HSP 1 Score: 273.863 bits (699), Expect = 9.202e-73
Identity = 141/245 (57.55%), Postives = 175/245 (71.43%), Query Frame = 1
Query:  157 MASTSLEPVASTSEAATVARTERSGFDQLPKEMNEMRIRDEKNVNHDDKDLEPSIVNGNGTEAGQVIATTVGGRNGQPKQTISYMAERVVGTGSFGVVFQAKCLETGDSVAIKNVLXG*RYKNRELQIMRLLNHPNVVSLKHCFFSTTEKDELYLNPVLEYISETVYRVS*HYTRMNXHVPILYVQLYTYQICRALKLLHHVGGGGSFETLATKFIGHPHTHQLKNVTFEVPKCLCQVNPT*RYL 891
            M S  L PV+   E+++       G D+LP+EMN+MRIRD       DK++E +IV+GNGTE G +I TT+GGR+GQPKQTISYMAER+VG GSFGVVFQAKCLETG++VAIK VL   RYKNRELQ MRLL+HPNVV LKHCFFSTTEKDE+YLN VLEY+ ETV+RV  HY ++N  +P++ V+LYTYQI RAL  +HH  G    +      + +PHTHQ+K   F   K L +  P   Y+
Sbjct:    1 MTSVGLAPVSGLRESSS----HSVGVDRLPEEMNDMRIRD-------DKEIEAAIVDGNGTETGHIIVTTIGGRHGQPKQTISYMAERIVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVCLKHCFFSTTEKDEVYLNLVLEYVPETVHRVIKHYNKLNQRMPLILVKLYTYQIFRALSYIHHTIGVCHRDIKPQNLLVNPHTHQVKLCDFGSAKVLVKGEPNISYI 234          
BLAST of EY659278 vs. ExPASy Swiss-Prot
Match: KSG5_ARATH (Shaggy-related protein kinase epsilon OS=Arabidopsis thaliana GN=ASK5 PE=2 SV=1)

HSP 1 Score: 271.937 bits (694), Expect = 3.497e-72
Identity = 142/245 (57.96%), Postives = 174/245 (71.02%), Query Frame = 1
Query:  157 MASTSLEPVASTSEAATVARTERSGFDQLPKEMNEMRIRDEKNVNHDDKDLEPSIVNGNGTEAGQVIATTVGGRNGQPKQTISYMAERVVGTGSFGVVFQAKCLETGDSVAIKNVLXG*RYKNRELQIMRLLNHPNVVSLKHCFFSTTEKDELYLNPVLEYISETVYRVS*HYTRMNXHVPILYVQLYTYQICRALKLLHHVGGGGSFETLATKFIGHPHTHQLKNVTFEVPKCLCQVNPT*RYL 891
            MAS    P +S    AT         ++LP+ +NEM+I+D       DK++E ++V+GNGTE G +I TT+GG+NGQPKQTISYMAER+VG GSFG+VFQAKCLETG++VAIK VL   RYKNRELQ MRLL+HPNVVSLKHCFFSTTEKDELYLN VLEY+ ETVYRVS HY+R N  +PI+YV+LYTYQICRAL  +H   G    +      + +PHTHQ+K   F   K L +  P   Y+
Sbjct:    1 MASVGTLPASSM---ATKQSNASICAEKLPEGINEMKIKD-------DKEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPETVYRVSKHYSRANQRMPIIYVKLYTYQICRALAYIHGGVGVCHRDIKPQNLLVNPHTHQVKLCDFGSAKVLVKGEPNISYI 235          
BLAST of EY659278 vs. ExPASy Swiss-Prot
Match: KSG3_ARATH (Shaggy-related protein kinase gamma OS=Arabidopsis thaliana GN=ASK3 PE=2 SV=1)

HSP 1 Score: 268.855 bits (686), Expect = 2.960e-71
Identity = 141/245 (57.55%), Postives = 174/245 (71.02%), Query Frame = 1
Query:  157 MASTSLEPVASTSEAATVARTERSGFDQLPKEMNEMRIRDEKNVNHDDKDLEPSIVNGNGTEAGQVIATTVGGRNGQPKQTISYMAERVVGTGSFGVVFQAKCLETGDSVAIKNVLXG*RYKNRELQIMRLLNHPNVVSLKHCFFSTTEKDELYLNPVLEYISETVYRVS*HYTRMNXHVPILYVQLYTYQICRALKLLHHVGGGGSFETLATKFIGHPHTHQLKNVTFEVPKCLCQVNPT*RYL 891
            MAS  +EP A+  E+        +  D+LP+EM +M+I+D       DK++E +IVNGN TE G +I TT+GGRNGQPKQTISYMAERVVG GSFGVVFQAKCLETG++VAIK VL   RYKNRELQ MRLL+HPNVVSLKHCFFSTTEKDELYLN VLEY+ ETV+RV  HY ++N  +P++YV+LYTYQI R+L  +H   G    +      + +PHTHQ+K   F   K L +  P   Y+
Sbjct:    1 MASVGIEPSAAVRESTGNV----TDADRLPEEMKDMKIQD-------DKEMEATIVNGNVTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPETVHRVIKHYNKLNQRMPLVYVKLYTYQIFRSLSYIHRCIGVCHRDIKPQNLLVNPHTHQVKLCDFGSAKVLVKGEPNISYI 234          
BLAST of EY659278 vs. ExPASy Swiss-Prot
Match: MSK3_MEDSA (Glycogen synthase kinase-3 homolog MsK-3 OS=Medicago sativa GN=MSK-3 PE=2 SV=2)

HSP 1 Score: 268.085 bits (684), Expect = 5.049e-71
Identity = 136/221 (61.54%), Postives = 165/221 (74.66%), Query Frame = 1
Query:  229 GFDQLPKEMNEMRIRDEKNVNHDDKDLEPSIVNGNGTEAGQVIATTVGGRNGQPKQTISYMAERVVGTGSFGVVFQAKCLETGDSVAIKNVLXG*RYKNRELQIMRLLNHPNVVSLKHCFFSTTEKDELYLNPVLEYISETVYRVS*HYTRMNXHVPILYVQLYTYQICRALKLLHHVGGGGSFETLATKFIGHPHTHQLKNVTFEVPKCLCQVNPT*RYL 891
            G ++LP+EMN+M+IRD+K +         +IV+GNGTE G +I TT+GG+NGQPKQTISYMAERVVG GSFGVVFQAKCLETG++VAIK VL   RYKNRELQ MRLL+HPNVVSLKHCFFSTTEKDELYLN VLEY+ ETV RV  HY +MN  +P++YV+LY+YQICRAL  +H+  G    +      + +PHTHQLK   F   K L +  P   Y+
Sbjct:   21 GVEKLPEEMNDMKIRDDKEME------AATIVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPETVSRVIRHYNKMNQRMPMIYVKLYSYQICRALAYIHNSIGVCHRDIKPQNLLVNPHTHQLKICDFGSAKVLVKGEPNISYI 235          
BLAST of EY659278 vs. ExPASy Swiss-Prot
Match: MSK1_MEDSA (Glycogen synthase kinase-3 homolog MsK-1 OS=Medicago sativa GN=MSK-1 PE=2 SV=1)

HSP 1 Score: 266.929 bits (681), Expect = 1.125e-70
Identity = 140/245 (57.14%), Postives = 174/245 (71.02%), Query Frame = 1
Query:  157 MASTSLEPVASTSEAATVARTERSGFDQLPKEMNEMRIRDEKNVNHDDKDLEPSIVNGNGTEAGQVIATTVGGRNGQPKQTISYMAERVVGTGSFGVVFQAKCLETGDSVAIKNVLXG*RYKNRELQIMRLLNHPNVVSLKHCFFSTTEKDELYLNPVLEYISETVYRVS*HYTRMNXHVPILYVQLYTYQICRALKLLHHVGGGGSFETLATKFIGHPHTHQLKNVTFEVPKCLCQVNPT*RYL 891
            MAS  + P +   E   +   E    D LP+EM++M+IRD       D+++E ++V+GNGTE G +I TT+GGRNGQPKQTISYMAERVVG GSFGVVFQAKCLETG++VAIK VL   RYKNRELQ MRLL+HPNVVSLKHCFFSTTEKDELYLN VLEY+ ETV+RV  HY+++N  +P++YV+LYTYQI RAL  +H   G    +      + +PHTHQ+K   F   K L +  P   Y+
Sbjct:    1 MASVGVAPTSGFREV--LGDGEIGVDDILPEEMSDMKIRD-------DREMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPETVHRVIKHYSKLNQRMPMIYVKLYTYQIFRALSYIHRCIGVCHRDIKPQNLLVNPHTHQVKLCDFGSAKVLVKGEPNISYI 236          
BLAST of EY659278 vs. ExPASy Swiss-Prot
Match: MSK2_MEDSA (Glycogen synthase kinase-3 homolog MsK-2 OS=Medicago sativa GN=MSK-2 PE=2 SV=1)

HSP 1 Score: 264.618 bits (675), Expect = 5.582e-70
Identity = 136/237 (57.38%), Postives = 168/237 (70.89%), Query Frame = 1
Query:  181 VASTSEAATVARTERSGFDQLPKEMNEMRIRDEKNVNHDDKDLEPSIVNGNGTEAGQVIATTVGGRNGQPKQTISYMAERVVGTGSFGVVFQAKCLETGDSVAIKNVLXG*RYKNRELQIMRLLNHPNVVSLKHCFFSTTEKDELYLNPVLEYISETVYRVS*HYTRMNXHVPILYVQLYTYQICRALKLLHHVGGGGSFETLATKFIGHPHTHQLKNVTFEVPKCLCQVNPT*RYL 891
            VA  S    V  +     D+LP E+  MRI+D       DK++E  +V+GN TEAG VI TT+GG+NGQPKQTISYMAER VG GSFGVVFQAKCLETG++VAIK VL   RYKNRELQ MRLL+HPNVV+LKHCFFSTTEKDELYLN VLE++ ETV+RV  HY++MN  +P++YV+LY+YQICR+L  +H+  G    +      + +PHTHQLK   F   K L +  P   Y+
Sbjct:    6 VAPASGIVDVNASSAIAVDKLPDEILGMRIKD-------DKEMEAHVVDGNSTEAGHVIVTTIGGKNGQPKQTISYMAERAVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVTLKHCFFSTTEKDELYLNLVLEFVPETVHRVIRHYSKMNQRMPLIYVKLYSYQICRSLAYIHNCVGVSHRDIKPQNLLVNPHTHQLKLCDFGSAKVLVKGEPNISYI 235          
BLAST of EY659278 vs. ExPASy Swiss-Prot
Match: KSG10_ARATH (Shaggy-related protein kinase kappa OS=Arabidopsis thaliana GN=ASK10 PE=1 SV=2)

HSP 1 Score: 238.81 bits (608), Expect = 3.280e-62
Identity = 125/245 (51.02%), Postives = 167/245 (68.16%), Query Frame = 1
Query:  157 MASTSLEPVASTSEAATVARTERSGFDQLPKEMNEMRIRDEKNVNHDDKDLEPSIVNGNGTEAGQVIATTVGGRNGQPKQTISYMAERVVGTGSFGVVFQAKCLETGDSVAIKNVLXG*RYKNRELQIMRLLNHPNVVSLKHCFFSTTEKDELYLNPVLEYISETVYRVS*HYTRMNXHVPILYVQLYTYQICRALKLLHHVGGGGSFETLATKFIGHPHTHQLKNVTFEVPKCLCQVNPT*RYL 891
            MAS+ L     TS +A   ++  S  D L +++ E RIRD+   + D++D EP I++G G E G VI TT+ GRNGQ +QT+SY++E VVGTGSFG+VFQAKC ETG+ VAIK VL   RYKNRELQIM++L+HPN V+LKH FFS T+ +E+YLN VLE++ ETV RV+  Y+R N  +P++YV+LYTYQICRAL  +H+  G    +      + +PHTHQLK   F   K L +  P   Y+
Sbjct:    1 MASSGLGNGVGTSRSAKGLKSSSSSVDWLTRDLAETRIRDKVETD-DERDSEPDIIDGAGAEPGHVIRTTLRGRNGQSRQTVSYISEHVVGTGSFGMVFQAKCRETGEVVAIKKVLQDKRYKNRELQIMQMLDHPNAVALKHSFFSRTDNEEVYLNLVLEFVPETVNRVARSYSRTNQLMPLIYVKLYTYQICRALAYIHNSFGLCHRDIKPQNLLVNPHTHQLKICDFGSAKVLVKGEPNVSYI 244          
The following BLAST results are available for this feature:
BLAST of EY659278 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 33
Match NameE-valueIdentityDescription
KSG8_ARATH7.257e-8658.05Shaggy-related protein kinase theta OS=Arabidopsis... [more]
KSGT_BRANA1.914e-7854.61Shaggy-related protein kinase theta OS=Brassica na... [more]
KSG1_ARATH4.130e-7359.07Shaggy-related protein kinase alpha OS=Arabidopsis... [more]
MSK1_TOBAC9.202e-7357.55Shaggy-related protein kinase NtK-1 OS=Nicotiana t... [more]
KSG5_ARATH3.497e-7257.96Shaggy-related protein kinase epsilon OS=Arabidops... [more]
KSG3_ARATH2.960e-7157.55Shaggy-related protein kinase gamma OS=Arabidopsis... [more]
MSK3_MEDSA5.049e-7161.54Glycogen synthase kinase-3 homolog MsK-3 OS=Medica... [more]
MSK1_MEDSA1.125e-7057.14Glycogen synthase kinase-3 homolog MsK-1 OS=Medica... [more]
MSK2_MEDSA5.582e-7057.38Glycogen synthase kinase-3 homolog MsK-2 OS=Medica... [more]
KSG10_ARATH3.280e-6251.02Shaggy-related protein kinase kappa OS=Arabidopsis... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-008-D03-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659278 ID=EY659278|Name=EY659278|organism=Citrus sinensis|type=EST|length=919bp
ATGCGCCGTCTCAATAGCATTGCTTCTGGTCGCACTTCTATTTCTTCTGA
TCCGGGTGGAGATTCTGGCATAAAGAGGGCAAAGGTCGATAAAGAATTAG
AGGTAAATGGGGAAGCAAATTTGGTTGAAAGAAGTGCCTCCAGTCTAGAG
CAGCATATGGCTTCTACATCTCTGGAGCCTGTTGCAAGCACGTCCGAAGC
AGCCACAGTTGCTAGAACTGAAAGATCAGGTTTTGATCAACTGCCTAAGG
AAATGAATGAGATGAGAATAAGAGATGAAAAAAATGTTAACCATGATGAT
AAGGATTTGGAACCCTCAATTGTCAATGGCAATGGAACAGAAGCAGGTCA
AGTCATTGCTACTACAGTAGGTGGTCGAAATGGACAACCAAAGCAGACAA
TCTCCTATATGGCAGAACGTGTGGTGGGGACTGGTTCCTTTGGTGTTGTC
TTCCAAGCTAAGTGCCTTGAAACAGGGGACTCTGTTGCAATAAAGAATGT
GCTCCNAGGATAGAGATACAAGAATAGGGAACTCCAAATTATGCGTTTAC
TTAACCATCCTAATGTTGTTTCTCTGAAACATTGTTTCTTTTCAACTACT
GAGAAAGATGAGCTTTATCTTAACCCTGTCTTGGAGTATATATCTGAAAC
TGTCTACCGAGTTTCATAGCACTATACCAGAATGAACCANCATGTGCCCA
TTCTTTACGTGCAGCTGTATACATACCAGATTTGCCGTGCACTGAAATTA
CTGCATCATGTTGGTGGGGGTGGGTCATTCGAGACTTTAGCCACAAAATT
TATTGGTCATCCCCATACACACCAGTTAAAGAATGTGACTTTTGAAGTGC
CAAAATGTTTGTGCCAAGTGAACCCAACCTAACGGTATCTGGTCAGAATT
ACAAGCCCCCGGACTTATA
back to top