EY659276

Overview
NameEY659276
Unique NameEY659276
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length927
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659276 vs. ExPASy Swiss-Prot
Match: PATM2_SOLTU (Patatin group M-2 OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 3.134e-44
Identity = 101/229 (44.10%), Postives = 144/229 (62.88%), Query Frame = 1
Query:   25 FVVLYKIMI---TNTIAKGKK-IAVLSIDGGGVRGIIPGTILAFLESQLQDLDGPK-ARIADYFDIVSGTSTGGLIATMLTAPDKDRRPIFAAKDINKFYFKHCPEIFPQDSCKNFPRSVTSPLRKWVRPMYDGKYMRTLTNRILGEITIKDTLTNLIIPTFDVKRA*PVIFSPNDGKIHALKNARLADMCIGTFGASTYLPAHWFVTKDSITGDTCGFDLNDGGVAAM 696
            F++L+ +++   ++T AK +K + VLSIDGGG++GIIP  IL FLE QLQ++D  K AR+ADYFD++ GTSTGGL+  M+T P+++ RP  AAKDI  FYF+H P IF      N+  S+       + PMYDGKY+  +    LGE  +   LT + I +FD+K   PVIF+ ++       +A++ D+C  T  A  Y P H+F+T  S  GD   F+L DGGVA +
Sbjct:    7 FLILFFMILATTSSTCAKLEKMVTVLSIDGGGIKGIIPAIILEFLEGQLQEVDNNKDARLADYFDVIGGTSTGGLLTAMITTPNENNRPFAAAKDIVPFYFEHGPHIF------NYSGSI-------IGPMYDGKYLLQVLQEKLGETRVHQALTEVAISSFDIKTNKPVIFTKSNLAKSPELDAKMYDICYSTAAAPIYFPPHYFITHTS-NGDIYEFNLVDGGVATV 221          
BLAST of EY659276 vs. ExPASy Swiss-Prot
Match: PATM1_SOLTU (Patatin group M-1 OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 5.345e-44
Identity = 99/229 (43.23%), Postives = 140/229 (61.14%), Query Frame = 1
Query:   25 FVVLYKIMITNTIAKGKK----IAVLSIDGGGVRGIIPGTILAFLESQLQDLDGPK-ARIADYFDIVSGTSTGGLIATMLTAPDKDRRPIFAAKDINKFYFKHCPEIFPQDSCKNFPRSVTSPLRKWVRPMYDGKYMRTLTNRILGEITIKDTLTNLIIPTFDVKRA*PVIFSPNDGKIHALKNARLADMCIGTFGASTYLPAHWFVTKDSITGDTCGFDLNDGGVAAM 696
            F++L+ +++  T +   K    + VLSIDGGG++GIIP  IL FLE QLQ++D  K AR+ADYFD++ GTSTGGL+  M+T P+++ RP  AAKDI  FYF+H P IF      N+  S+       + PMYDGKY+  +    LGE  +   LT + I +FD+K   PVIF+ ++       +A++ D+C  T  A  Y P H+F+T  S  GD   F+L DGGVA +
Sbjct:    7 FLILFFMILATTSSTCAKLEEMVTVLSIDGGGIKGIIPAIILEFLEGQLQEVDNNKDARLADYFDVIGGTSTGGLLTAMITTPNENNRPFAAAKDIVPFYFEHGPHIF------NYSGSI-------IGPMYDGKYLLQVLQEKLGETRVHQALTEVAISSFDIKTNKPVIFTKSNLAKSPELDAKMYDICYSTAAAPIYFPPHYFITHTS-NGDIYEFNLVDGGVATV 221          
BLAST of EY659276 vs. ExPASy Swiss-Prot
Match: PAT14_SOLTU (Patatin-14 OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 5.345e-44
Identity = 99/229 (43.23%), Postives = 140/229 (61.14%), Query Frame = 1
Query:   25 FVVLYKIMITNTIAKGKK----IAVLSIDGGGVRGIIPGTILAFLESQLQDLDGPK-ARIADYFDIVSGTSTGGLIATMLTAPDKDRRPIFAAKDINKFYFKHCPEIFPQDSCKNFPRSVTSPLRKWVRPMYDGKYMRTLTNRILGEITIKDTLTNLIIPTFDVKRA*PVIFSPNDGKIHALKNARLADMCIGTFGASTYLPAHWFVTKDSITGDTCGFDLNDGGVAAM 696
            F++L+ +++  T +   K    + VLSIDGGG++GIIP  IL FLE QLQ++D  K AR+ADYFD++ GTSTGGL+  M+T P+++ RP  AAKDI  FYF+H P IF      N+  S+       + PMYDGKY+  +    LGE  +   LT + I +FD+K   PVIF+ ++       +A++ D+C  T  A  Y P H+F+T  S  GD   F+L DGGVA +
Sbjct:    7 FLILFFMILATTSSTCAKLEEMVTVLSIDGGGIKGIIPAIILEFLEGQLQEVDNNKDARLADYFDVIGGTSTGGLLTAMITTPNENNRPFAAAKDIVPFYFEHGPHIF------NYSGSI-------IGPMYDGKYLLQVLQEKLGETRVHQALTEVAISSFDIKTNKPVIFTKSNLAKSPELDAKMYDICYSTAAAPIYFPPHYFITHTS-NGDIYEFNLVDGGVATV 221          
BLAST of EY659276 vs. ExPASy Swiss-Prot
Match: PAT10_SOLTU (Patatin-10 OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 5.345e-44
Identity = 99/229 (43.23%), Postives = 140/229 (61.14%), Query Frame = 1
Query:   25 FVVLYKIMITNTIAKGKK----IAVLSIDGGGVRGIIPGTILAFLESQLQDLDGPK-ARIADYFDIVSGTSTGGLIATMLTAPDKDRRPIFAAKDINKFYFKHCPEIFPQDSCKNFPRSVTSPLRKWVRPMYDGKYMRTLTNRILGEITIKDTLTNLIIPTFDVKRA*PVIFSPNDGKIHALKNARLADMCIGTFGASTYLPAHWFVTKDSITGDTCGFDLNDGGVAAM 696
            F++L+ +++  T +   K    + VLSIDGGG++GIIP  IL FLE QLQ++D  K AR+ADYFD++ GTSTGGL+  M+T P+++ RP  AAKDI  FYF+H P IF      N+  S+       + PMYDGKY+  +    LGE  +   LT + I +FD+K   PVIF+ ++       +A++ D+C  T  A  Y P H+F+T  S  GD   F+L DGGVA +
Sbjct:    7 FLILFFMILATTSSTCAKLEEMVTVLSIDGGGIKGIIPAIILEFLEGQLQEVDNNKDARLADYFDVIGGTSTGGLLTAMITTPNENNRPFAAAKDIVPFYFEHGPHIF------NYSGSI-------IGPMYDGKYLLQVLQEKLGETRVHQALTEVAISSFDIKTNKPVIFTKSNLAKSPELDAKMYDICYSTAAAPIYFPPHYFITHTS-NGDIYEFNLVDGGVATV 221          
BLAST of EY659276 vs. ExPASy Swiss-Prot
Match: PT2K3_SOLTU (Patatin-2-Kuras 3 OS=Solanum tuberosum GN=pat2-k3 PE=1 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 1.191e-43
Identity = 101/227 (44.49%), Postives = 136/227 (59.91%), Query Frame = 1
Query:   28 VVLYKIMITNT---IAKGKKIAVLSIDGGGVRGIIPGTILAFLESQLQDLDGPK-ARIADYFDIVSGTSTGGLIATMLTAPDKDRRPIFAAKDINKFYFKHCPEIFPQDSCKNFPRSVTSPLRKWVRPMYDGKYMRTLTNRILGEITIKDTLTNLIIPTFDVKRA*PVIFSPNDGKIHALKNARLADMCIGTFGASTYLPAHWFVTKDSITGDTCGFDLNDGGVAAM 696
            V+ + I+ T +      G+ + VLSIDGGG++GIIP TIL FLE QLQ++D  K AR+ADYFD++ GTSTGGL+  M+T P+++ RP  AAKDI  FYF+H P IF      N   S+         PMYDGKY   +    LGE  +   LT + I +FD+K   PVIF+ ++       +A++ D+C  T  A TY P H+FVT  S  GD   F+L DG VA +
Sbjct:    9 VLFFMILATTSSTCATLGEMVTVLSIDGGGIKGIIPATILEFLEGQLQEVDNNKDARLADYFDVIGGTSTGGLLTAMITTPNENNRPFAAAKDIVPFYFEHGPHIF------NSSGSIFG-------PMYDGKYFLQVLQEKLGETRVHQALTEVAISSFDIKTNKPVIFTKSNLAKSPELDAKMYDICYSTAAAPTYFPPHYFVTHTS-NGDKYEFNLVDGAVATV 221          
BLAST of EY659276 vs. ExPASy Swiss-Prot
Match: PT2K2_SOLTU (Patatin-2-Kuras 2 OS=Solanum tuberosum GN=pat2-k2 PE=2 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 1.555e-43
Identity = 98/229 (42.79%), Postives = 139/229 (60.70%), Query Frame = 1
Query:   25 FVVLYKIMITNTIAK----GKKIAVLSIDGGGVRGIIPGTILAFLESQLQDLDGPK-ARIADYFDIVSGTSTGGLIATMLTAPDKDRRPIFAAKDINKFYFKHCPEIFPQDSCKNFPRSVTSPLRKWVRPMYDGKYMRTLTNRILGEITIKDTLTNLIIPTFDVKRA*PVIFSPNDGKIHALKNARLADMCIGTFGASTYLPAHWFVTKDSITGDTCGFDLNDGGVAAM 696
            F++L+ +++  T +     G+ + VLSIDGGG++GIIP  IL FLE QLQ++D  K AR+ADYFD++ GTSTGGL+  M+T P+++ RP  AAKDI  FYF+H P IF      N+  S+         PMYDGKY+  +    LGE  +   LT + I +FD+K   PVIF+ ++       +A++ D+C  T  A  Y P H+F+T  S  GD   F+L DG VA +
Sbjct:    7 FLILFFMILATTSSTCATLGEMVTVLSIDGGGIKGIIPAVILEFLEGQLQEVDNNKDARLADYFDVIGGTSTGGLLTAMITTPNENNRPFAAAKDIIPFYFEHGPHIF------NYSGSIFG-------PMYDGKYLLQVLQEKLGETRVHQALTEVAISSFDIKTNKPVIFTKSNLAKSPELDAKMYDICYSTAAAPMYFPPHYFITHTS-DGDIYEFNLVDGAVATV 221          
BLAST of EY659276 vs. ExPASy Swiss-Prot
Match: PT2K4_SOLTU (Patatin-2-Kuras 4 OS=Solanum tuberosum GN=pat2-k4 PE=2 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 2.653e-43
Identity = 96/210 (45.71%), Postives = 130/210 (61.90%), Query Frame = 1
Query:   70 GKKIAVLSIDGGGVRGIIPGTILAFLESQLQDLDG-PKARIADYFDIVSGTSTGGLIATMLTAPDKDRRPIFAAKDINKFYFKHCPEIFPQDSCKNFPRSVTSPLRKWVRPMYDGKYMRTLTNRILGEITIKDTLTNLIIPTFDVKRA*PVIFSPNDGKIHALKNARLADMCIGTFGASTYLPAHWFVTKDSITGDTCGFDLNDGGVAAM 696
            G+ + VLSIDGGG++GIIP  IL FLE QLQ++D    AR+ADYFD++ GTSTGGL+  M+T P+++ RP  AAKDI  FYF+H P IF      N+  S+       + PMYDGKY+  +    LGE  +   LT + I +FD+K   PVIF+ ++       +A++ D+C  T  A  Y P H+FVT  S  GD   F+L DGGVA +
Sbjct:   14 GEMVTVLSIDGGGIKGIIPAIILEFLEGQLQEVDNNADARLADYFDVIGGTSTGGLLTAMITTPNENNRPFAAAKDIVPFYFEHGPHIF------NYSGSI-------LGPMYDGKYLLQVLQEKLGETRVHQALTEVAISSFDIKTNKPVIFTKSNLAESPQLDAKMYDICYSTAAAPIYFPPHYFVTHTS-NGDRYEFNLVDGGVATV 209          
BLAST of EY659276 vs. ExPASy Swiss-Prot
Match: PATM3_SOLTU (Patatin group M-3 OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 2.653e-43
Identity = 98/229 (42.79%), Postives = 139/229 (60.70%), Query Frame = 1
Query:   25 FVVLYKIMITNTIAKGKK----IAVLSIDGGGVRGIIPGTILAFLESQLQDLDGPK-ARIADYFDIVSGTSTGGLIATMLTAPDKDRRPIFAAKDINKFYFKHCPEIFPQDSCKNFPRSVTSPLRKWVRPMYDGKYMRTLTNRILGEITIKDTLTNLIIPTFDVKRA*PVIFSPNDGKIHALKNARLADMCIGTFGASTYLPAHWFVTKDSITGDTCGFDLNDGGVAAM 696
            F++L+ +++  T +   K    + VLSIDGGG++GIIP  IL FLE QLQ++D  K AR+ADYFD++ GTSTGGL+  M+T P+++ RP  AAKDI  FY +H P IF      N+  S+       + PMYDGKY+  +    LGE  +   LT + I +FD+K   PVIF+ ++       +A++ D+C  T  A  Y P H+F+T  S  GD   F+L DGGVA +
Sbjct:    7 FLILFFMILATTSSTCAKLEEMVTVLSIDGGGIKGIIPAIILEFLEGQLQEVDNNKDARLADYFDVIGGTSTGGLLTAMITTPNENNRPFAAAKDIVPFYLEHGPHIF------NYSGSI-------IGPMYDGKYLLQVLQEKLGETRVHQALTEVAISSFDIKTNKPVIFTKSNLAKSPELDAKMYDICYSTAAAPIYFPPHYFITHTS-NGDIYEFNLVDGGVATV 221          
BLAST of EY659276 vs. ExPASy Swiss-Prot
Match: PAT05_SOLTU (Patatin-05 OS=Solanum tuberosum GN=pat1-k1 PE=1 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 2.653e-43
Identity = 97/227 (42.73%), Postives = 135/227 (59.47%), Query Frame = 1
Query:   28 VVLYKIMITNT---IAKGKKIAVLSIDGGGVRGIIPGTILAFLESQLQDLDG-PKARIADYFDIVSGTSTGGLIATMLTAPDKDRRPIFAAKDINKFYFKHCPEIFPQDSCKNFPRSVTSPLRKWVRPMYDGKYMRTLTNRILGEITIKDTLTNLIIPTFDVKRA*PVIFSPNDGKIHALKNARLADMCIGTFGASTYLPAHWFVTKDSITGDTCGFDLNDGGVAAM 696
            V+++ I+ T +      G+ + VLSIDGGG++GIIPG IL FLE QLQ +D    AR+ADYFD++ GTSTGGL+  M+T P+++ RP  AAKDI  FYF+H P IF             S   ++  P YDGKY+  +    LGE  +   LT + I +FD+K   PVIF+ ++       +A+++D+C  T  A TY P H+F T  S  GD   F+L DG VA +
Sbjct:    9 VLIFMILATTSSTFATLGEMVTVLSIDGGGIKGIIPGIILEFLEGQLQKMDNNADARLADYFDVIGGTSTGGLLTAMITTPNENNRPFAAAKDIVPFYFQHGPHIF------------NSSTGQFFGPKYDGKYLMQVLQEKLGETRVHQALTEVAISSFDIKTNKPVIFTKSNLAKSPELDAKMSDICYSTAAAPTYFPPHYFATNTS-NGDKYEFNLVDGAVATV 222          
BLAST of EY659276 vs. ExPASy Swiss-Prot
Match: PAT03_SOLTU (Patatin-03 OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 2.653e-43
Identity = 97/227 (42.73%), Postives = 135/227 (59.47%), Query Frame = 1
Query:   28 VVLYKIMITNT---IAKGKKIAVLSIDGGGVRGIIPGTILAFLESQLQDLDG-PKARIADYFDIVSGTSTGGLIATMLTAPDKDRRPIFAAKDINKFYFKHCPEIFPQDSCKNFPRSVTSPLRKWVRPMYDGKYMRTLTNRILGEITIKDTLTNLIIPTFDVKRA*PVIFSPNDGKIHALKNARLADMCIGTFGASTYLPAHWFVTKDSITGDTCGFDLNDGGVAAM 696
            V+++ I+ T +      G+ + VLSIDGGG++GIIPG IL FLE QLQ +D    AR+ADYFD++ GTSTGGL+  M+T P+++ RP  AAKDI  FYF+H P IF             S   ++  P YDGKY+  +    LGE  +   LT + I +FD+K   PVIF+ ++       +A+++D+C  T  A TY P H+F T  S  GD   F+L DG VA +
Sbjct:    9 VLIFMILATTSSTFATLGEMVTVLSIDGGGIKGIIPGIILEFLEGQLQKMDNNADARLADYFDVIGGTSTGGLLTAMITTPNENNRPFAAAKDIVPFYFQHGPHIF------------NSSTGQFFGPKYDGKYLMQVLQEKLGETRVHQALTEVAISSFDIKTNKPVIFTKSNLARSPELDAKMSDICYSTAAAPTYFPPHYFATNTS-NGDKYEFNLVDGAVATV 222          
The following BLAST results are available for this feature:
BLAST of EY659276 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 34
Match NameE-valueIdentityDescription
PATM2_SOLTU3.134e-4444.10Patatin group M-2 OS=Solanum tuberosum PE=2 SV=1[more]
PATM1_SOLTU5.345e-4443.23Patatin group M-1 OS=Solanum tuberosum PE=2 SV=1[more]
PAT14_SOLTU5.345e-4443.23Patatin-14 OS=Solanum tuberosum PE=2 SV=1[more]
PAT10_SOLTU5.345e-4443.23Patatin-10 OS=Solanum tuberosum PE=2 SV=1[more]
PT2K3_SOLTU1.191e-4344.49Patatin-2-Kuras 3 OS=Solanum tuberosum GN=pat2-k3 ... [more]
PT2K2_SOLTU1.555e-4342.79Patatin-2-Kuras 2 OS=Solanum tuberosum GN=pat2-k2 ... [more]
PT2K4_SOLTU2.653e-4345.71Patatin-2-Kuras 4 OS=Solanum tuberosum GN=pat2-k4 ... [more]
PATM3_SOLTU2.653e-4342.79Patatin group M-3 OS=Solanum tuberosum PE=2 SV=1[more]
PAT05_SOLTU2.653e-4342.73Patatin-05 OS=Solanum tuberosum GN=pat1-k1 PE=1 SV... [more]
PAT03_SOLTU2.653e-4342.73Patatin-03 OS=Solanum tuberosum PE=2 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-008-D01-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659276 ID=EY659276|Name=EY659276|organism=Citrus sinensis|type=EST|length=927bp
CTTTCTTTTATATGCCTAGCACCATTTGTGGTCTTATACAAAATCATGAT
TACTAATACCATCGCCAAAGGCAAGAAAATAGCCGTGCTGAGCATTGATG
GCGGCGGCGTTAGGGGCATCATTCCTGGCACTATTTTGGCCTTTCTTGAA
TCCCAGCTTCAGGATCTGGACGGACCCAAGGCGAGAATTGCAGATTATTT
CGATATAGTTTCAGGAACAAGCACAGGTGGGCTAATAGCCACCATGCTTA
CAGCCCCCGACAAGGACCGCAGACCTATTTTTGCTGCAAAGGATATCAAC
AAATTTTATTTTAAGCACTGTCCTGAAATTTTCCCTCAAGATAGCTGTAA
GAATTTTCCAAGATCAGTTACAAGCCCTTTGCGTAAGTGGGTACGACCAA
TGTACGATGGGAAGTACATGCGGACTCTTACGAACAGGATACTAGGAGAA
ATTACCATCAAAGATACCCTAACAAATTTGATCATTCCAACTTTTGACGT
CAAGCGGGCTTAGCCAGTGATATTCTCACCCAATGATGGAAAAATACATG
CTTTGAAGAATGCCCGGCTTGCTGATATGTGCATTGGCACCTTTGGAGCT
TCCACCTACTTACCAGCGCACTGGTTTGTGACCAAAGATTCAATTACCGG
CGACACATGTGGGTTTGATCTCAATGATGGGGGGGTTGCGGCAATGACCC
CGTAAGTAACTTCATTTTTGGAACCTGGGGGCCATATCTGGGGATTGACA
ATAAATTATTGGGGGATTTGGAATATATGAGGGAAAGATAATGAATGTGT
TAACCCTTAGGGCCCTAACCCGCTTTTGCTGGAGGGTTTAAACATAAGCC
TGGGTCGATGCTTAAACCATTTACACCGGGGAACCTACTCTTGGCCTAGG
GCAGGGGCGGCCAGGGACCACCATTCC
back to top