EY659226

Overview
NameEY659226
Unique NameEY659226
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length874
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659226 vs. ExPASy Swiss-Prot
Match: Y1669_ARATH (Uncharacterized oxidoreductase At1g06690, chloroplastic OS=Arabidopsis thaliana GN=At1g06690 PE=1 SV=1)

HSP 1 Score: 447.973 bits (1151), Expect = 3.310e-125
Identity = 219/284 (77.11%), Postives = 246/284 (86.62%), Query Frame = 2
Query:    2 LKVTKLGVGAWSWGDTXYWNNFQWDDRKMKAAKAAFDTSLDNGITFFDTAEVYGSRASFGAINSETLLGRFIKERKQRDPEVEVTVATKFAALPWRLGRQSVLAALKDSLFRLGLSSVELYQLHWAGIWGNEGFIDGLGDAVEXGLVKAVGVSNYSEKRLRNAYEKLKKRGIPLASNQVNYSLIYRKPEENGVKAACDELGITLIAYCPIAQGALTGKYTPQNPPTGPRGRIYTAEYLRNLQPLLNRIKELXENYSKTSHQ*SSTGYXAR-QWCAXPQSQNAEQ 850
            LKVTKLG+G WSWGD  YWN+FQWDDRK+KAAK AFDTSLDNGI FFDTAEVYGS+ S GAI+SETLLGRFI+ERK+R P  EV+VATKFAALPWR GR+SV+ ALKDSL RL LSSV+LYQLHW G+WGNEG++DGLGDAVE GLVKAVGVSNYSEKRLR+AYE+LKKRGIPLASNQVNYSLIYR PE+ GVKAACDELG+TLIAY PIAQGALTGKYTP+NPP+GPRGRIYT E+L  LQPLLNRIK++ ENYSKT  Q +     A+      P ++NAEQ
Sbjct:   56 LKVTKLGIGVWSWGDNSYWNDFQWDDRKLKAAKGAFDTSLDNGIDFFDTAEVYGSKFSLGAISSETLLGRFIRERKERYPGAEVSVATKFAALPWRFGRESVVTALKDSLSRLELSSVDLYQLHWPGLWGNEGYLDGLGDAVEQGLVKAVGVSNYSEKRLRDAYERLKKRGIPLASNQVNYSLIYRAPEQTGVKAACDELGVTLIAYSPIAQGALTGKYTPENPPSGPRGRIYTREFLTKLQPLLNRIKQIGENYSKTPTQIALNWLVAQGNVIPIPGAKNAEQ 339          
BLAST of EY659226 vs. ExPASy Swiss-Prot
Match: Y2320_MYCBO (Uncharacterized oxidoreductase Mb2320 OS=Mycobacterium bovis GN=Mb2320 PE=3 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 2.888e-20
Identity = 87/258 (33.72%), Postives = 129/258 (50.00%), Query Frame = 2
Query:    5 KVTKLGVGAWSWGDTXYWNNFQWDDRKMKAAKAAFDTSLDNGITFFDTAEVYGSRASFGAINSETLLGRFIKERKQRDPEVEVTVATK-FAALPWRLGRQSVLAALKD----SLFRLGLSSVELYQLHWAG-IWGNEGFIDGLGDAVEXGLVKAVGVSNYSEKRLRNAYEKLKKRGIPLASNQVNYSLIYRKPEENGVKAACDELGITLIAYCPIAQGALTGKYTPQNPPTGPR--GRIYTAEYLRNLQPLLNRIKEL 754
            +V+++G+G W +G   +      D     AA+     +   G+T FDTAE+YG         SE +LG  +      D   EV VA+K F   P+        A +K+    S  RL L+ + LYQ+H    +  +   + G+ D ++ G + A GVSNYS  R R A   L   G P+ SNQV++SL +    E+ V  A  E  I +IAY P+AQG L GKY  +N P G R    ++  E LR ++PLL  ++ +
Sbjct:   11 QVSRIGLGTWQFGSREWGYG---DRYATGAARDIVKRARALGVTLFDTAEIYGLG------KSERILGEALG-----DDRTEVVVASKVFPVAPFP-------AVIKNRERASARRLQLNRIPLYQIHQPNPVVPDSVIMPGMRDLLDSGDIGAAGVSNYSLARWRKADAAL---GRPVVSNQVHFSLAHPDALEDLVPFAELENRI-VIAYSPLAQGLLGGKYGLENRPGGVRALNPLFGTENLRRIEPLLATLRAI 243          
BLAST of EY659226 vs. ExPASy Swiss-Prot
Match: Y2298_MYCTU (Uncharacterized oxidoreductase Rv2298/MT2355 OS=Mycobacterium tuberculosis GN=Rv2298 PE=3 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 2.888e-20
Identity = 87/258 (33.72%), Postives = 129/258 (50.00%), Query Frame = 2
Query:    5 KVTKLGVGAWSWGDTXYWNNFQWDDRKMKAAKAAFDTSLDNGITFFDTAEVYGSRASFGAINSETLLGRFIKERKQRDPEVEVTVATK-FAALPWRLGRQSVLAALKD----SLFRLGLSSVELYQLHWAG-IWGNEGFIDGLGDAVEXGLVKAVGVSNYSEKRLRNAYEKLKKRGIPLASNQVNYSLIYRKPEENGVKAACDELGITLIAYCPIAQGALTGKYTPQNPPTGPR--GRIYTAEYLRNLQPLLNRIKEL 754
            +V+++G+G W +G   +      D     AA+     +   G+T FDTAE+YG         SE +LG  +      D   EV VA+K F   P+        A +K+    S  RL L+ + LYQ+H    +  +   + G+ D ++ G + A GVSNYS  R R A   L   G P+ SNQV++SL +    E+ V  A  E  I +IAY P+AQG L GKY  +N P G R    ++  E LR ++PLL  ++ +
Sbjct:   11 QVSRIGLGTWQFGSREWGYG---DRYATGAARDIVKRARALGVTLFDTAEIYGLG------KSERILGEALG-----DDRTEVVVASKVFPVAPFP-------AVIKNRERASARRLQLNRIPLYQIHQPNPVVPDSVIMPGMRDLLDSGDIGAAGVSNYSLARWRKADAAL---GRPVVSNQVHFSLAHPDALEDLVPFAELENRI-VIAYSPLAQGLLGGKYGLENRPGGVRALNPLFGTENLRRIEPLLATLRAI 243          
BLAST of EY659226 vs. ExPASy Swiss-Prot
Match: YAJO_ECOLI (Uncharacterized oxidoreductase yajO OS=Escherichia coli (strain K12) GN=yajO PE=3 SV=2)

HSP 1 Score: 92.8189 bits (229), Expect = 2.703e-18
Identity = 69/222 (31.08%), Postives = 118/222 (53.15%), Query Frame = 2
Query:    2 LKVTKLGVGAWSWGDTXYWNNFQWDDRKMKAAKAAFDTSLDNGITFFDTAEVYGSRASFGAINSETLLGRFIKERKQRDPEVEVTVATKF----AALPWRLGRQSVLAALKDSLFRLGLSSVELYQLH-WAGIWGNEGFIDGLGDAVEXGLVKAVGVSNYSEKRLRNAYEKLKKRG-IPLASNQVNYSLIYRKPEENGVKAACDELGITLIAYCPIAQGALT 649
            L+V++L +G  ++G+    N+  W   + ++++     +L+ GI FFDTA  Y   +S      E ++GR +++  +R+   +V VATK       LP  L R  +L ++ DSL RLG+  V++ Q+H W      E  ++ L D V+ G  + +G S+    +   A E  K+ G     S Q +Y+LIYR+ EE  +   C + G+ +I + P+A+G LT
Sbjct:   11 LRVSRLCLGCMTFGEPDRGNH-AWTLPE-ESSRPIIKRALEGGINFFDTANSYSDGSS------EEIVGRALRDFARRE---DVVVATKVFHRVGDLPEGLSRAQILRSIDDSLRRLGMDYVDILQIHRWDYNTPIEETLEALNDVVKAGKARYIGASSMHASQFAQALELQKQHGWAQFVSMQDHYNLIYRE-EEREMLPLCYQEGVAVIPWSPLARGRLT 220          
BLAST of EY659226 vs. ExPASy Swiss-Prot
Match: GS69_BACSU (General stress protein 69 OS=Bacillus subtilis GN=yhdN PE=1 SV=2)

HSP 1 Score: 90.8929 bits (224), Expect = 1.027e-17
Identity = 71/230 (30.87%), Postives = 117/230 (50.87%), Query Frame = 2
Query:    2 LKVTKLGVGAWSWGDTXYWNNFQWDDRKMKAAKAAFDTSLDNGITFFDTAEVYGSRASFGAINSETLLGRFIKERKQRDPEVEVTVATKFAALPWR-------LGRQSVLAALKDSLFRLGLSSVELYQLHWAG-IWGNEGFIDGLGDAVEXGLVKAVGVSNYSEKRLRNAYEKLKKRGIPLASNQVNYSLIYRKPEENGVKAACDELGITLIAYCPIAQGALTGKYTPQ 667
            ++ +++G+G W+ G T       W     K +      +LD GIT  DTA  YG    FG   SE ++G+ IKE  +RD   +V +ATK  AL W+         R  ++  +++SL RL    ++LYQ+HW   +   E   + + +  + G ++A+GVSN+S +++        +   PL + Q  Y+L  R+ EE+ +  A D   IT + Y  + +G LTGK T +
Sbjct:   11 IEASRIGLGTWAIGGT------MWGGTDEKTSIETIRAALDQGITLIDTAPAYG----FG--QSEEIVGKAIKEYGKRD---QVILATK-TALDWKNNQLFRHANRARIVEEVENSLKRLQTDYIDLYQVHWPDPLVPIEETAEVMKELYDAGKIRAIGVSNFSIEQMDTF-----RAVAPLHTIQPPYNLFEREMEESVLPYAKDN-KITTLLYGSLCRGLLTGKMTEE 218          
BLAST of EY659226 vs. ExPASy Swiss-Prot
Match: YGHZ_ECOLI (Uncharacterized protein yghZ OS=Escherichia coli (strain K12) GN=yghZ PE=1 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 4.316e-16
Identity = 67/210 (31.90%), Postives = 106/210 (50.48%), Query Frame = 2
Query:   56 WNNFQWDDRKMKAAKAAFDTSLDNGITFFDTAEVYGSRASFGAINSETLLGRFIKE--RKQRDPEVEVTVATKFAALPWRL------GRQSVLAALKDSLFRLGLSSVELYQLHWAGI-WGNEGFIDGLGDAVEXGLVKAVGVSNYSEKRLRNAYEKLKKRGIPLASNQVNYSLIYRKPEENGVKAACDELGITLIAYCPIAQGALTGKY 658
            W+NF   +  +++ +A    + D GIT FD A  YG        ++E   GR ++E     RD   E+ ++TK     W         R+ +LA+L  SL R+GL  V+++  H        E     L  AV+ G    VG+S+YS +R +   E L++  IPL  +Q +Y+L+ R  +++G+       G+  IA+ P+AQG LTGKY
Sbjct:   33 WHNFGHVNA-LESQRAILRKAFDLGITHFDLANNYGPPPG----SAEENFGRLLREDFAAYRD---ELIISTKAGYDMWPGPYGSGGSRKYLLASLDQSLKRMGLEYVDIFYSHRVDENTPMEETASALAHAVQSGKALYVGISSYSPERTQKMVELLREWKIPLLIHQPSYNLLNRWVDKSGLLDTLQNNGVGCIAFTPLAQGLLTGKY 234          
BLAST of EY659226 vs. ExPASy Swiss-Prot
Match: YI7E_SCHPO (Putative aryl-alcohol dehydrogenase C977.14c OS=Schizosaccharomyces pombe GN=SPAC977.14c PE=1 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 7.362e-16
Identity = 78/288 (27.08%), Postives = 127/288 (44.10%), Query Frame = 2
Query:    2 LKVTKLGVGAWSWGDTXYWNNFQWDDRK--MKAAKAAFDTSLDNGITFFDTAEVYGSRASFGAINSETLLGRFIKERKQRDPEVEVTVATK------------FAALPWR---------------LGRQSVLAALKDSLFRLGLSSVELYQLH-WAGIWGNEGFIDGLGDAVEXGLVKAVGVSNYSEKRLRNAYEKLKKRGIPLASNQVNYSLIYRKPEENGVKAACDELGITLIAYCPIAQGALTGKYTPQNPPTGPRGRIYT--AEYLRNLQPLLNRIKELXENYS 769
            LKV+KL +G  S+G   YW ++  +D +   K  KAA+D     GI  FDTA  Y +  S      E L+G+FI  RK   P   + + +K            F  L  R               L R+ +  A++DS+ RLG + +++ Q+H +      E  +  L D VE G V+ +G S     +        +K G     +  NY  +  + EE  +   C + G+ LI + P+A+G LT            +  +YT   E+    + +L+R++EL + Y+
Sbjct:   17 LKVSKLILGCMSYGKKEYWEDWVLEDEEEVFKIMKAAYDA----GIRTFDTANCYSAGVS------EELVGKFI--RKYEIPRSSIVILSKCFFPVRKDLIKIFGDLSSRGVHFLDSPELANQCGLSRKHIFDAVEDSVKRLG-TYIDVLQIHRYDPHVSAEEVMRALNDVVESGKVRYIGASTMRCYQFIELQNTAEKHGWHKFISMQNYHNLLYREEEREMIPYCQKTGVGLIPWSPLARGLLTRSIDANEETIRSKTDLYTRALEFGAGYKAILSRVEELAKKYN 291          
BLAST of EY659226 vs. ExPASy Swiss-Prot
Match: YGHZ_ECO57 (Uncharacterized protein yghZ OS=Escherichia coli O157:H7 GN=yghZ PE=4 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 9.615e-16
Identity = 67/210 (31.90%), Postives = 105/210 (50.00%), Query Frame = 2
Query:   56 WNNFQWDDRKMKAAKAAFDTSLDNGITFFDTAEVYGSRASFGAINSETLLGRFIKE--RKQRDPEVEVTVATKFAALPWRL------GRQSVLAALKDSLFRLGLSSVELYQLHWAGI-WGNEGFIDGLGDAVEXGLVKAVGVSNYSEKRLRNAYEKLKKRGIPLASNQVNYSLIYRKPEENGVKAACDELGITLIAYCPIAQGALTGKY 658
            W+NF   +  +++ +A    + D GIT FD A  YG        ++E   GR ++E     RD   E+ ++TK     W         R+ +LA+L  SL R+GL  V+++  H        E     L  AV+ G    VG+S+YS +R +   E L +  IPL  +Q +Y+L+ R  +++G+       G+  IA+ P+AQG LTGKY
Sbjct:   33 WHNFGHVNA-LESQRAILRKAFDLGITHFDLANNYGPPPG----SAEENFGRLLREDFAAYRD---ELIISTKAGYDMWPGPYGSGGSRKYLLASLDQSLKRMGLEYVDIFYSHRVDENTPMEETASALAHAVQSGKALYVGISSYSPERTQKMVELLHEWKIPLLIHQPSYNLLNRWVDKSGLLDTLQNNGVGCIAFTPLAQGLLTGKY 234          
BLAST of EY659226 vs. ExPASy Swiss-Prot
Match: YRPG_BACSU (Uncharacterized oxidoreductase yrpG OS=Bacillus subtilis GN=yrpG PE=3 SV=2)

HSP 1 Score: 83.5741 bits (205), Expect = 1.640e-15
Identity = 85/272 (31.25%), Postives = 123/272 (45.22%), Query Frame = 2
Query:    2 LKVTKLGVGAWSWGDTXYWNNFQWDDRKMKAAKAAFDTSLDNGITFFDTAEVYGSRASFGAINSETLLGRFIKERKQRDPEVEVTVATKF---------AALPWR-LGRQSVLAALKDSLFRLGLSSVELYQLH-------WAGIWGNEGFIDGLGDAVEXGLVKAVGVSNYSEKRLRNAY-EKLKKRGIPLASNQVNYSLIYRKPEENGVKAACDELGITLIAYCPIAQGALTGKYTPQNPPTGPRGRIYTAEYLR-NLQPLLNRIKELXE 760
            L+V++L +G  ++G           D   K A    D +LDNGI FFDTA +YG   + G   +E+++G++  +  QR    +V +ATK               R L    +   L+ SL RL    +ELYQ+H       W  IW      +     V  G V  +G SN++   L  A  E  K+R + L + Q  YSL+ R  E   + AA D LG+ ++A+ P+A G L GK    N  T    R    E  R  L+   +  KEL E
Sbjct:   11 LRVSRLCLGTMNFGV----------DTDEKTAFRIMDEALDNGIQFFDTANIYGWGKNAGL--TESIIGKWFAQGGQR--REKVVLATKVYEPISDPNDGPNDMRGLSLYKIRRHLEGSLKRLQTDHIELYQMHHIDRRTPWDEIW------EAFETQVRSGKVDYIGSSNFAGWHLVKAQAEAEKRRFMGLVTEQHKYSLLERTAEMEVLPAARD-LGLGVVAWSPLAGGLLGGKALKSNAGTRTAKRADLIEKHRLQLEKFSDLCKELGE 261          
BLAST of EY659226 vs. ExPASy Swiss-Prot
Match: YAKC_SCHPO (Aldo-keto reductase yakc [NADP+] OS=Schizosaccharomyces pombe GN=yakc PE=1 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 8.140e-15
Identity = 73/238 (30.67%), Postives = 119/238 (50.00%), Query Frame = 2
Query:   89 KAAKAAFDTSLDNGITFFDTAEVYGSRASFGAINSETLLGRFIKERKQRDPEVEVTVATKFA--------ALPWRLGRQSVLAALKDSLFRLGLSSVELYQLH-WAGIWGNEGFIDGLGDAVEXGLVKAVGVSNYSEKRLRNAYEKLKKRGIPLASNQVNYSLIYRKPE--ENGVKAACDELGITLIAYCPIAQGALTGKY-TPQNPPTG----PRGRIYTAEYLRNLQPLLNRIKEL 754
            +A +A    + D G TF+D++++YG    FGA  +E  +GR+ K+  +R    E+ +ATKF          L        +  AL  SL RLG+  ++LY +H ++G    E  +  L   VE G ++ +G+S  S   +R A         P+++ QV YS    + E  E GV  AC E  IT++ Y P+ +G LTG Y +P + P G       R     + +NL+ L+ +I+++
Sbjct:   33 EANQAVLTHAADLGCTFWDSSDMYG----FGA--NEECIGRWFKQTGRRK---EIFLATKFGYEKNPETGELSLNNEPDYIEKALDLSLKRLGIDCIDLYYVHRFSGETPIEKIMGALKKCVEAGKIRYIGLSECSANTIRRAAAVY-----PVSAVQVEYSPFSLEIERPEIGVMKACRENNITIVCYAPLGRGFLTGAYKSPDDFPEGDFRRKAPRYQKENFYKNLE-LVTKIEKI 255          
The following BLAST results are available for this feature:
BLAST of EY659226 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 16
Match NameE-valueIdentityDescription
Y1669_ARATH3.310e-12577.11Uncharacterized oxidoreductase At1g06690, chloropl... [more]
Y2320_MYCBO2.888e-2033.72Uncharacterized oxidoreductase Mb2320 OS=Mycobacte... [more]
Y2298_MYCTU2.888e-2033.72Uncharacterized oxidoreductase Rv2298/MT2355 OS=My... [more]
YAJO_ECOLI2.703e-1831.08Uncharacterized oxidoreductase yajO OS=Escherichia... [more]
GS69_BACSU1.027e-1730.87General stress protein 69 OS=Bacillus subtilis GN=... [more]
YGHZ_ECOLI4.316e-1631.90Uncharacterized protein yghZ OS=Escherichia coli (... [more]
YI7E_SCHPO7.362e-1627.08Putative aryl-alcohol dehydrogenase C977.14c OS=Sc... [more]
YGHZ_ECO579.615e-1631.90Uncharacterized protein yghZ OS=Escherichia coli O... [more]
YRPG_BACSU1.640e-1531.25Uncharacterized oxidoreductase yrpG OS=Bacillus su... [more]
YAKC_SCHPO8.140e-1530.67Aldo-keto reductase yakc [NADP+] OS=Schizosaccharo... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-G08-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659226 ID=EY659226|Name=EY659226|organism=Citrus sinensis|type=EST|length=874bp
ATTGAAGGTGACAAAGCTTGGCGTTGGGGCTTGGTCATGGGGTGACACTA
NCTACTGGAATAACTTCCAATGGGATGACAGGAAGATGAAGGCTGCTAAA
GCTGCTTTTGATACCAGTCTGGATAATGGAATAACTTTTTTCGATACTGC
TGAAGTATATGGTTCTAGGGCCTCATTCGGTGCCATAAATTCCGAAACAC
TACTGGGAAGATTTATAAAGGAAAGGAAACAAAGGGATCCGGAAGTGGAG
GTTACTGTTGCAACCAAGTTTGCAGCTTTGCCATGGAGGCTGGGCCGTCA
GAGTGTCCTCGCTGCTCTTAAGGATTCCCTTTTCCGGCTTGGCCTTTCTT
CTGTTGAACTTTATCAGCTGCACTGGGCTGGAATTTGGGGAAATGAAGGG
TTTATTGATGGTCTTGGAGATGCTGTGGAGCANGGCCTTGTGAAGGCTGT
TGGTGTTTCAAATTACAGTGAGAAACGACTTCGCAATGCTTACGAAAAGC
TTAAAAAGAGAGGAATTCCATTAGCTTCAAACCAAGTGAACTATAGCCTC
ATATACAGAAAACCAGAAGAGAATGGTGTGAAGGCTGCCTGTGATGAACT
TGGGATCACTTTAATTGCATATTGTCCTATTGCTCAAGGTGCTCTCACTG
GAAAGTATACACCACAGAATCCACCAACTGGGCCTCGAGGCCGGATCTAC
ACTGCCGAGTATCTAAGAAATCTCCAACCACTGTTGAACAGAATCAAGGA
ACTANGAGAGAACTACAGCAAAACTTCACACCAGTAGTCCTCAACTGGCT
ATTNAGCCAGACAATGGTGTGCCNATCCCCAGAGCCAAAATGCAGAACAG
CTGCANAAATCGCGGTGCATTGGG
back to top