EY659217

Overview
NameEY659217
Unique NameEY659217
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length898
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig185 contig Csv1_Contig185:207..1104. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659217 vs. ExPASy Swiss-Prot
Match: XTH28_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 28 OS=Arabidopsis thaliana GN=XTH28 PE=2 SV=1)

HSP 1 Score: 402.905 bits (1034), Expect = 1.051e-114
Identity = 183/252 (72.62%), Postives = 218/252 (86.51%), Query Frame = 3
Query:   42 KTGSGFVSHDLYLHGFFSASIKLPADYTAGVVVAFYMSNGDMFEKNHDEIDFEFLGNIRGKNWRIQTNIYGNGSTSIGREERYNLWFDPSDDFHQYSILWTDSQIIFYIDGIPIREFKRTASMGGDFPAKPMSLYATIWDGSDWATNGGKYRVNYKYAPYVTEFSDFVLHGCSFDPIEQTSSKCDITESSKVSIPTGVSPSQRIKMENFXRKHMTYSYCYDQIRYKVPPFECVINPLEAERLKVHDPVTFXG 797
            +TGSGFVS+D+YLHGFFS+SIKLPADY+AGVV+AFY+SNGD++EKNHDEIDFEFLGNIRG+ WRIQTNIYGNGST +GREERYNLWFDP++DFHQYSILW+ S IIFY+D +PIRE KRTASMGGDFPAKPMSLY+TIWDGS WAT+GGKY VNYKYAPYV++F+D +LHGC+ DP E+  S C       + + + ++ SQR KME F +KHMTYSYCYD +RYKV   ECV+NP EA+RL+V+DPVTF G
Sbjct:   60 RTGSGFVSNDIYLHGFFSSSIKLPADYSAGVVIAFYLSNGDLYEKNHDEIDFEFLGNIRGREWRIQTNIYGNGSTHLGREERYNLWFDPTEDFHQYSILWSLSHIIFYVDNVPIREVKRTASMGGDFPAKPMSLYSTIWDGSKWATDGGKYGVNYKYAPYVSQFTDLILHGCAVDPTEKFPS-CKDEAVQNLRLASEITESQRNKMEIFRQKHMTYSYCYDHMRYKVVLSECVVNPAEAKRLRVYDPVTFGG 310          

HSP 2 Score: 32.3426 bits (72), Expect = 1.051e-114
Identity = 14/17 (82.35%), Postives = 15/17 (88.24%), Query Frame = 1
Query:    1 VHRDGKSVHLSLDERQG 51
            VHRDGKSV L+LDER G
Sbjct:   46 VHRDGKSVRLTLDERTG 62          
BLAST of EY659217 vs. ExPASy Swiss-Prot
Match: XTH27_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 27 OS=Arabidopsis thaliana GN=XTH27 PE=2 SV=2)

HSP 1 Score: 398.282 bits (1022), Expect = 7.418e-113
Identity = 184/252 (73.02%), Postives = 209/252 (82.94%), Query Frame = 3
Query:   42 KTGSGFVSHDLYLHGFFSASIKLPADYTAGVVVAFYMSNGDMFEKNHDEIDFEFLGNIRGKNWRIQTNIYGNGSTSIGREERYNLWFDPSDDFHQYSILWTDSQIIFYIDGIPIREFKRTASMGGDFPAKPMSLYATIWDGSDWATNGGKYRVNYKYAPYVTEFSDFVLHGCSFDPIEQTSSKCDITESSKVSIPTGVSPSQRIKMENFXRKHMTYSYCYDQIRYKVPPFECVINPLEAERLKVHDPVTFXG 797
            +TGSGFVS+D YLHGFFSASIKLP+DYTAGVVVAFYMSNGDM+EKNHDEIDFEFLGNIR K WR+QTNIYGNGST  GREERYNLWFDP++DFHQYSILW+DS IIF++D +PIRE KRTA MGG FP+KPMSLY TIWDGS WATNGGKY VNYKYAPY+  FSD VLHGC  DPIEQ   +CD   +  +     ++PSQR KM+ F R+ MTYSYCYD+ RY V   ECV+NP EA+RL+V+DPV F G
Sbjct:   60 RTGSGFVSNDYYLHGFFSASIKLPSDYTAGVVVAFYMSNGDMYEKNHDEIDFEFLGNIREKEWRVQTNIYGNGSTHSGREERYNLWFDPTEDFHQYSILWSDSHIIFFVDNVPIREVKRTAEMGGHFPSKPMSLYTTIWDGSKWATNGGKYGVNYKYAPYIARFSDLVLHGCPVDPIEQ-FPRCDEGAAEDMRAAQEITPSQRSKMDVFRRRLMTYSYCYDRARYNVALSECVVNPAEAQRLRVYDPVRFGG 310          

HSP 2 Score: 30.8018 bits (68), Expect = 7.418e-113
Identity = 13/17 (76.47%), Postives = 15/17 (88.24%), Query Frame = 1
Query:    1 VHRDGKSVHLSLDERQG 51
            VH+DGKSV L+LDER G
Sbjct:   46 VHQDGKSVRLTLDERTG 62          
BLAST of EY659217 vs. ExPASy Swiss-Prot
Match: XTH30_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 30 OS=Arabidopsis thaliana GN=XTH30 PE=2 SV=2)

HSP 1 Score: 330.872 bits (847), Expect = 6.134e-90
Identity = 156/258 (60.47%), Postives = 187/258 (72.48%), Query Frame = 3
Query:   45 TGSGFVSHDLYLHGFFSASIKLPADYTAGVVVAFYMSNGDMFEKNHDEIDFEFLGNIRGKNWRIQTNIYGNGSTSIGREERYNLWFDPSDDFHQYSILWTDSQIIFYIDGIPIREFKRTASMGGDFPAKPMSLYATIWDGSDWATNGGKYRVNYKYAPYVTEFSDFVLHGCSFDPIEQTSSKC----DITESSKVSIPTGVSPSQRIKMENFXRKHMTYSYCYDQIRYKVPPFECVINPLEAERLKVHDPVTFXGRAA 806
            TGSGF+S ++Y HGF+S+ IKLPADYTAGVVVAFY SNGD+FEK HDE+D EFLGNI+GK WR QTN+YGNGST  GREERY LWFDPS +FH+YSILWT  +IIF++D +PIRE  R  +MG D+PAKPM+LYATIWD SDWAT+GGKY+ NYK+AP+V EF  F L GCS DPI++    C    D  ES   S    ++  QR  M  F ++ M YSYCYD +RY  P  ECVI P E +R K    + F G  A
Sbjct:   62 TGSGFISSNMYQHGFYSSMIKLPADYTAGVVVAFYTSNGDVFEKTHDELDIEFLGNIKGKPWRFQTNLYGNGSTHRGREERYRLWFDPSKEFHRYSILWTPHKIIFWVDDVPIREVIRNDAMGADYPAKPMALYATIWDASDWATSGGKYKANYKFAPFVAEFKSFSLDGCSVDPIQEVPMDCSDSVDFLESQDYS---SINSHQRAAMRRFRQRFMYYSYCYDTLRYPEPLPECVIVPAEKDRFKETGRLKFGGTEA 316          
BLAST of EY659217 vs. ExPASy Swiss-Prot
Match: XTH29_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 29 OS=Arabidopsis thaliana GN=XTH29 PE=2 SV=1)

HSP 1 Score: 303.523 bits (776), Expect = 1.049e-81
Identity = 144/263 (54.75%), Postives = 182/263 (69.20%), Query Frame = 3
Query:   45 TGSGFVSHDLYLHGFFSASIKLPADYTAGVVVAFYMSNGDMFEKNHDEIDFEFLGNIRGKNWRIQTNIYGNGSTSIGREERYNLWFDPSDDFHQYSILWTDSQIIFYIDGIPIREFKRTASMGGDFPAKPMSLYATIWDGSDWATNGGKYRVNYKYAPYVTEFSDFVLHGCSFD---PIEQTSS--------KCDITESSKVSIP-TGVSPSQRIKMENFXRKHMTYSYCYDQIRYKVPPFECVINPLEAERLKVHDPVTFXG 797
            TGSGF+S  +Y HGFFS+ IKLP  YTAG+VVAFY SNGD+F K+HDE+D EFLGN+ GK WR QTN+YGNGST+ GREERY LWFDPS +FH+YSILWT ++IIF++D +PIRE  R   M GD+P KPMSLYATIWD S WAT+GGK+ V+Y ++P+V+EF D  L GC+     P E  ++         C +++   +S   + +SP Q   M  F  ++M YSYCYD IRY VPP ECVI   E  R +    + F G
Sbjct:   70 TGSGFISSSMYQHGFFSSLIKLPGAYTAGIVVAFYTSNGDVFVKDHDELDIEFLGNLEGKPWRFQTNMYGNGSTNRGREERYRLWFDPSKEFHRYSILWTPTKIIFWVDDVPIREILRKEEMNGDYPQKPMSLYATIWDASSWATSGGKFGVDYTFSPFVSEFKDIALDGCNVSDSFPGENNNNNIGNYNNINCSVSDQFLMSNDYSTISPKQATAMRRFRERYMYYSYCYDTIRYSVPPPECVIVTAEKNRFRDTGRLKFGG 332          
BLAST of EY659217 vs. ExPASy Swiss-Prot
Match: XTH33_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 33 OS=Arabidopsis thaliana GN=XTH33 PE=2 SV=2)

HSP 1 Score: 241.506 bits (615), Expect = 4.894e-63
Identity = 116/239 (48.54%), Postives = 153/239 (64.02%), Query Frame = 3
Query:   45 TGSGFVSHDLYLHGFFSASIKLPADYTAGVVVAFYMSNGDMFEKNHDEIDFEFLGNIRGKNWRIQTNIYGNGSTSIGREERYNLWFDPSDDFHQYSILWTDSQIIFYIDGIPIREFKRTASMGGDFPAKPMSLYATIWDGSDWATNGGKYRVNYKYAPYVTEFSDFVLHGCSFDPIEQT-SSKCDITESSKVSIP-------TGVSPSQRIKMENFXRKHMTYSYCYDQIRYKVPPFEC 737
            +G+G VS + Y +GFFSA +KLPA + +GVVVAFY+SN + + K+HDEID E LG  R  +W IQTN+Y NGST  GREE++  WFDP+  FH Y+++W     +F +D IP+R+F    +    +P+KPMSLY T+WDGS+WAT GGKY VNYKYAP+V   +D  L GCS +    T S  C  +  S  S+          +S +Q   M+   RK M YSYC D+ RYKV P EC
Sbjct:   71 SGAGLVSKNKYHYGFFSARLKLPAGFASGVVVAFYLSNAETYPKSHDEIDIELLGRSRRDDWTIQTNVYANGSTRTGREEKFYFWFDPTQAFHDYTLIWNSHHTVFLVDNIPVRQFPNRGAFTSAYPSKPMSLYVTVWDGSEWATKGGKYPVNYKYAPFVVSVADVELSGCSVNNGSSTGSGPCTKSGGSISSLDPVDGQDFATLSKNQINAMDWARRKLMFYSYCSDKPRYKVMPAEC 309          
BLAST of EY659217 vs. ExPASy Swiss-Prot
Match: XTH2_ARATH (Xyloglucan endotransglucosylase/hydrolase protein 2 OS=Arabidopsis thaliana GN=XTH2 PE=2 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 1.093e-54
Identity = 107/233 (45.92%), Postives = 145/233 (62.23%), Query Frame = 3
Query:   45 TGSGFVSHDLYLHGFFSASIKLPADYTAGVVVAFYM-SNGDMFEKNHDEIDFEFLGNIRGKNWRIQTNIYGNGSTSIGREERYNLWFDPSDDFHQYSILWTDSQIIFYIDGIPIREFKRTASMGGDFPAKPMSLYATIWDGSDWATNGGKYRVNYKYAPYVTEFSDFVLHGCSFDPIEQTSSKCDITES-SKVSIPTGVSPSQRIKMENFXRKHMTYSYCYDQIRYKVPPFEC 737
            +GSGF S   Y  GFF   IKLP   +AGVV AFY+ S GD     HDE+DFEFLGN +GK   IQTN++ NG    GRE+++  WFDP+  FH Y ILW   QI+FY+D +PIR FK     G ++P+KPM L A++W+G +WAT+GGK ++N+ YAP+  ++  F  HGC  +     ++ C  T         + +S +++  MEN   K+MTY YC D+ RY VPP EC
Sbjct:   62 SGSGFESKSHYGSGFFQMRIKLPPRDSAGVVTAFYLTSKGD----THDEVDFEFLGNRQGKPIAIQTNVFSNGQG--GREQKFVPWFDPTTSFHTYGILWNPYQIVFYVDKVPIRVFKNIKKSGVNYPSKPMQLVASLWNGENWATSGGKEKINWAYAPFKAQYQGFSDHGCHVNGQSNNANVCGSTRYWWNTRTYSQLSANEQKVMENVRAKYMTYDYCSDRPRYPVPPSEC 288          
BLAST of EY659217 vs. ExPASy Swiss-Prot
Match: XTH1_ARATH (Putative xyloglucan endotransglucosylase/hydrolase protein 1 OS=Arabidopsis thaliana GN=XTH1 PE=2 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 9.574e-51
Identity = 103/238 (43.28%), Postives = 146/238 (61.34%), Query Frame = 3
Query:   45 TGSGFVSHDLYLHGFFSASIKLPADYTAGVVVAFYMSNGDMFEKNHDEIDFEFLGNIRGKNWRIQTNIYGNGSTSIGREERYNLWFDPSDDFHQYSILWTDSQIIFYIDGIPIREFKRTASMGGDFPAKPMSLYATIWDGSDWATNGGKYRVNYKYAPYVTEFSDFVLHGCSFDPIEQTSSKCDITESSKVSIPTG----VSPSQRIKMENFXRKHMTYSYCYDQIRYKVPPFECVIN 746
            +GSGF S + Y  GFF   IK+P   T+GVV AFY+++       HDE+DFEFLGN  GK   +QTN++ NG  +  RE++  LWFDPS DFH Y+ILW   QI+ Y+D IP+R FK T S G ++P+KPM +  ++W+G +WAT+GGK ++N+  AP+   F  F   GC       T+++ +   SS     TG    +S S++    N  +K+M Y YC D++R+ VPP EC  N
Sbjct:   69 SGSGFESKNHYESGFFQIRIKVPPKDTSGVVTAFYLTSKG---NTHDEVDFEFLGNKEGK-LAVQTNVFTNGKGN--REQKLALWFDPSKDFHTYAILWNPYQIVLYVDNIPVRVFKNTTSQGMNYPSKPMQVVVSLWNGENWATDGGKSKINWSLAPFKANFQGFNNSGCF------TNAEKNACGSSAYWWNTGSYSKLSDSEQKAYTNVRQKYMNYDYCSDKVRFHVPPSECKWN 294          
BLAST of EY659217 vs. ExPASy Swiss-Prot
Match: XTH3_ARATH (Xyloglucan endotransglucosylase/hydrolase protein 3 OS=Arabidopsis thaliana GN=XTH3 PE=2 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 1.633e-50
Identity = 100/235 (42.55%), Postives = 142/235 (60.43%), Query Frame = 3
Query:   45 TGSGFVSHDLYLHGFFSASIKLPADYTAGVVVAFYMSNGDMFEKNHDEIDFEFLGNIRGKNWRIQTNIYGNGSTSIGREERYNLWFDPSDDFHQYSILWTDSQIIFYIDGIPIREFKRTASMGGDFPAKPMSLYATIWDGSDWATNGGKYRVNYKYAPYVTEFSDFVLHGCSFDPIEQTSSKCDITESSKVSIPTG----VSPSQRIKMENFXRKHMTYSYCYDQIRYKVPPFEC 737
            +G GF S D Y  G F   IK+P+  T G+V AFY+++       HDEIDFEFLGN  GK   +QTN++ NG  +  REER+ LWF+P+  +H Y +LW   QI+FY+D IPIR +K     G  +P+KPM + A++W+G DWAT+GG+ +VN+ Y+P++  F DF L GC+ D        C   ESS      G    +S +++   E+   K+M Y YC D+ +Y+ PP EC
Sbjct:   65 SGGGFESKDAYGSGLFEMRIKVPSGNTGGIVTAFYLTSKG---GGHDEIDFEFLGNNNGKPVTLQTNLFLNGEGN--REERFLLWFNPTKHYHTYGLLWNPYQIVFYVDNIPIRVYKN--ENGVSYPSKPMQVEASLWNGDDWATDGGRTKVNWSYSPFIAHFRDFALSGCNIDGRSNNVGAC---ESSNYWWNAGNYQRLSGNEQKLYEHVRSKYMNYDYCTDRSKYQTPPREC 289          
BLAST of EY659217 vs. ExPASy Swiss-Prot
Match: XTH31_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 31 OS=Arabidopsis thaliana GN=XTH31 PE=2 SV=2)

HSP 1 Score: 192.2 bits (487), Expect = 3.405e-48
Identity = 97/234 (41.45%), Postives = 137/234 (58.55%), Query Frame = 3
Query:   45 TGSGFVSHDLYLHGFFSASIKLPADYTAGVVVAFYMSNGDMFEKNHDEIDFEFLGNIRGKNWRIQTNIYGNGS---TSIGREERYNLWFDPSDDFHQYSILWTDSQIIFYIDGIPIREFKRTASMGGDFPAKPMSLYATIWDGSDWATNGGKYRVNYKYAPYVTEFSDFVLHGCSFDPIEQTSSKCDITESSKVSIPTGVSPSQRIKMENFXRKHMTYSYCYDQIRYKVPPFEC 737
            TGSGF S   Y  G+F ASIKL   +TAGV  + Y+SN      +HDE+D EFLG   GK + +QTN++  GS     IGRE ++ LWFDP+ DFH Y+ILW  +QI+F++D +PIR + R       FP +PM +Y +IWD SDWAT  G+ + +Y+Y P+V ++ +F L GC+ D    +SS C     + +    G+S  Q   +    R  + Y+YC+D  R      EC
Sbjct:   67 TGSGFKSLRPYRSGYFGASIKLQPGFTAGVDTSLYLSNNQEHPGDHDEVDIEFLGTTPGKPYSLQTNVFVRGSGDRNVIGREMKFTLWFDPTQDFHHYAILWNPNQIVFFVDDVPIRTYNRKNE--AIFPTRPMWVYGSIWDASDWATENGRIKADYRYQPFVAKYKNFKLAGCTAD----SSSSCRPPSPAPMR-NRGLSRQQMAALTWAQRNFLVYNYCHDPKRDHTQTPEC 293          
BLAST of EY659217 vs. ExPASy Swiss-Prot
Match: XTH5_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 5 OS=Arabidopsis thaliana GN=XTH5 PE=2 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 3.187e-46
Identity = 94/235 (40.00%), Postives = 144/235 (61.28%), Query Frame = 3
Query:   45 TGSGFVSHDLYLHGFFSASIKLPADYTAGVVVAFYMSNGDMFEKNHDEIDFEFLGNIRGKNWRIQTNIYGNGSTSIGREERYNLWFDPSDDFHQYSILWTDSQIIFYIDGIPIREFKRTASMGGDFP-AKPMSLYATIWDGSDWATNGGKYRVNYKYAPYVTEFSDFVLHGCSFDPIEQTSSKCDITESSK---VSIPTGVSPSQRIKMENFXRKHMTYSYCYDQIRYKVPPFEC 737
            TG+GF S   YL G FS  IK+ A  +AG V AFY+S+ +     HDEIDFEFLGN  G+ + +QTN++  G+ +  RE+R NLWFDPS D+H YS+LW   QI+F++D +PIR FK +  +G  FP  +PM +Y+++W+  DWAT GG  + N++ AP+V  +  F + GC        ++K   T+  +         +  +Q  +++   +++  Y+YC D++R+ VPP EC
Sbjct:   62 TGTGFQSKGSYLFGHFSMHIKMVAGDSAGTVTAFYLSSQN---SEHDEIDFEFLGNRTGQPYILQTNVFTGGAGN--REQRINLWFDPSKDYHSYSVLWNMYQIVFFVDDVPIRVFKNSKDVGVKFPFNQPMKIYSSLWNADDWATRGGLEKTNWEKAPFVASYRGFHVDGCE----ASVNAKFCETQGKRWWDQKEFQDLDANQYKRLKWVRKRYTIYNYCTDRVRFPVPPPEC 287          
The following BLAST results are available for this feature:
BLAST of EY659217 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 48
Match NameE-valueIdentityDescription
XTH28_ARATH1.051e-11472.62Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH27_ARATH7.418e-11373.02Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH30_ARATH6.134e-9060.47Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH29_ARATH1.049e-8154.75Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH33_ARATH4.894e-6348.54Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH2_ARATH1.093e-5445.92Xyloglucan endotransglucosylase/hydrolase protein ... [more]
XTH1_ARATH9.574e-5143.28Putative xyloglucan endotransglucosylase/hydrolase... [more]
XTH3_ARATH1.633e-5042.55Xyloglucan endotransglucosylase/hydrolase protein ... [more]
XTH31_ARATH3.405e-4841.45Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH5_ARATH3.187e-4640.00Probable xyloglucan endotransglucosylase/hydrolase... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-F10-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659217 ID=EY659217|Name=EY659217|organism=Citrus sinensis|type=EST|length=898bp
GTTCATAGAGATGGAAAATCTGTTCATTTATCTCTAGATGAAAGACAGGG
TCTGGATTTGTGTCACATGACCTCTATCTTCATGGTTTCTTCAGTGCTTC
AATAAAGTTGCCTGCTGATTATACTGCCGGCGTTGTTGTTGCCTTCTATA
TGTCAAATGGTGACATGTTTGAGAAGAATCATGATGAAATAGACTTTGAG
TTCTTGGGTAATATTAGAGGCAAAAATTGGAGGATTCAGACTAATATTTA
TGGCAATGGAAGCACCAGCATCGGAAGAGAAGAGAGATACAATCTCTGGT
TTGATCCTTCTGATGATTTCCATCAGTACAGTATTCTCTGGACTGATTCC
CAGATCATATTTTATATAGACGGTATTCCAATTAGGGAGTTTAAGAGAAC
TGCATCTATGGGAGGAGATTTTCCTGCTAAGCCGATGTCTTTGTACGCCA
CAATCTGGGATGGCTCTGATTGGGCTACAAATGGTGGCAAATACCGAGTG
AACTACAAATATGCTCCCTATGTGACTGAATTCTCTGACTTCGTACTCCA
CGGATGTTCATTTGATCCTATTGAGCAAACTTCTTCCAAGTGTGACATAA
CCGAAAGTTCCAAAGTATCAATCCCTACTGGCGTCTCCCCATCACAGAGA
ATTAAAATGGAAAACTTTANGAGGAAGCATATGACCTATTCCTACTGCTA
TGACCAAATTCGATACAAAGTTCCTCCATTTGAGTGTGTGATCAACCCCC
TTGAGGCGGAGCGCCTTAAAGTACACGATCCAGTTACATTCNGGGGGAGG
GCGGCGCCATCACGGGAAACGACACCACCGAGCCGATCAAGCGAACCAAG
NNCAATGACGTTGAGGAGACTATATGCTACATGCAGACACTATTTGTC
back to top