EY659084

Overview
NameEY659084
Unique NameEY659084
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length936
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659084 vs. ExPASy Swiss-Prot
Match: RR1_SPIOL (30S ribosomal protein S1, chloroplastic OS=Spinacia oleracea GN=RPS1 PE=1 SV=1)

HSP 1 Score: 266.929 bits (681), Expect = 1.155e-70
Identity = 134/189 (70.90%), Postives = 161/189 (85.19%), Query Frame = 2
Query:   59 MATLAQQFTG-LRCPPISHTRLSRRKSITQIQQKLLNSRKNKTIVSAVAISNAETREREELNQLFEEAYERCRTAPMEGVSFTLEEFHSALEKYDFNSELGTKVKGTVFCTDNRGALVDITAKSSAYLPTQEACIHKIKHVEEAGIVPGLKEEFVIIGENEADDSLVLSLRMIQYELAWERCXQLQSED 622
            MA+LAQQ  G LRCPP+S++ LS+  S      K     +   IVSAVA+SNA+TRER++L QLFE+AYERCR APMEGVSFT+++FH+AL+KYDFNSE+G++VKGTVFCTD  GALVDITAKSSAYLP  EACI++IK+VEEAGI+PG++EEFVIIGENEADDSL+LSLR IQYELAWERC QLQ+ED
Sbjct:    1 MASLAQQLAGGLRCPPLSNSNLSKPFS-----PKHTLKPRFSPIVSAVAVSNAQTRERQKLKQLFEDAYERCRNAPMEGVSFTIDDFHTALDKYDFNSEMGSRVKGTVFCTDANGALVDITAKSSAYLPLAEACIYRIKNVEEAGIIPGVREEFVIIGENEADDSLILSLRQIQYELAWERCRQLQAED 184          
BLAST of EY659084 vs. ExPASy Swiss-Prot
Match: RS1A_SYNY3 (30S ribosomal protein S1 homolog A OS=Synechocystis sp. (strain PCC 6803) GN=rps1A PE=3 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 1.096e-20
Identity = 51/110 (46.36%), Postives = 72/110 (65.45%), Query Frame = 2
Query:  293 VSFTLEEFHSALEKYDFNSELGTKVKGTVFCTDNRGALVDITAKSSAYLPTQEACIHKIKHVEEAGIVPGLKEEFVIIGENEADDSLVLSLRMIQYELAWERCXQLQSED 622
            + FTLE+F + L+KYD++   G  V GTVF  ++RGAL+DI AK++AY+P QE  I+++   EE  + P    EF I+ +   D  L LS+R I+Y  AWER  QLQ+ED
Sbjct:   10 IGFTLEDFAALLDKYDYHFSPGDIVAGTVFSMESRGALIDIGAKTAAYIPIQEMSINRVDDPEEV-LQPNETREFFILTDENEDGQLTLSIRRIEYMRAWERVRQLQAED 118          
BLAST of EY659084 vs. ExPASy Swiss-Prot
Match: RS1_SYNP6 (30S ribosomal protein S1 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=rpsA PE=1 SV=4)

HSP 1 Score: 97.4413 bits (241), Expect = 1.212e-19
Identity = 50/114 (43.86%), Postives = 72/114 (63.16%), Query Frame = 2
Query:  281 PMEGVSFTLEEFHSALEKYDFNSELGTKVKGTVFCTDNRGALVDITAKSSAYLPTQEACIHKIKHVEEAGIVPGLKEEFVIIGENEADDSLVLSLRMIQYELAWERCXQLQSED 622
            P   + FT E+F + L++YD++   G  V GTVF  + RGAL+DI AK++A+LP QE  I++++  EE  + P    EF I+ +   D  L LS+R I+Y  AWER  QLQ+ED
Sbjct:    7 PAVDIGFTHEDFAALLDQYDYHFNPGDTVVGTVFNLEPRGALIDIGAKTAAFLPVQEMSINRVESPEEV-LQPSEMREFFILSDENEDGQLTLSIRRIEYMRAWERVRQLQTED 119          
BLAST of EY659084 vs. ExPASy Swiss-Prot
Match: RR1_PORPU (30S ribosomal protein S1, chloroplastic OS=Porphyra purpurea GN=rps1 PE=3 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 6.027e-11
Identity = 41/110 (37.27%), Postives = 59/110 (53.64%), Query Frame = 2
Query:  296 SFTLEEFHSALEKYDFNSELGTKVKGTVFCTDNRGALVDITAKSSAYLPTQEACIH-KIKHVEEAGIVPGLKEEFVIIGENEADDSLVLSLRMIQYELAWERCXQLQSED 622
            SFT   F + L+KY ++  LG  V GT+F  +  G LVDI    SAYLP QE   + ++ +     I      EF ++  N     L+LS+R ++Y  AW+R  QL +ED
Sbjct:    7 SFTHRNFAAVLQKYKYDLNLGDIVAGTIFSFELNGVLVDIGTPVSAYLPIQEVSSNQELNNFNSLNI--NDTREFFLLDYNVESRQLILSIRRLEYIRAWKRIRQLLAED 114          
The following BLAST results are available for this feature:
BLAST of EY659084 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
RR1_SPIOL1.155e-7070.9030S ribosomal protein S1, chloroplastic OS=Spinaci... [more]
RS1A_SYNY31.096e-2046.3630S ribosomal protein S1 homolog A OS=Synechocysti... [more]
RS1_SYNP61.212e-1943.8630S ribosomal protein S1 OS=Synechococcus sp. (str... [more]
RR1_PORPU6.027e-1137.2730S ribosomal protein S1, chloroplastic OS=Porphyr... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-001-C02-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659084 ID=EY659084|Name=EY659084|organism=Citrus sinensis|type=EST|length=936bp
CCACGCGTCCGGAACCATAGGAAAGCTAAAAACTTGGCGAGCTGAAGGGA
AAGCAAGAATGGCGACCTTGGCTCAACAGTTCACAGGACTAAGATGCCCA
CCAATCTCACACACACGCCTCTCAAGAAGAAAATCGATTACCCAAATTCA
ACAAAAGCTTCTGAATAGCAGAAAAAATAAAACGATAGTGTCAGCAGTGG
CAATATCAAATGCAGAGACTAGAGAGAGGGAGGAGCTCAATCAGCTCTTT
GAAGAAGCTTACGAACGGTGTCGTACTGCTCCCATGGAAGGCGTCTCTTT
CACTCTCGAGGAGTTTCACTCTGCTCTTGAGAAGTATGACTTCAATTCTG
AATTAGGTACTAAAGTAAAGGGAACAGTTTTTTGTACAGATAACCGTGGA
GCACTGGTCGATATTACTGCAAAGTCATCTGCTTATTTGCCTACCCAAGA
GGCATGCATTCACAAGATTAAACATGTAGAAGAGGCAGGTATAGTTCCGG
GGTTGAAGGAGGAGTTTGTAATTATTGGTGAAAATGAAGCTGATGATAGC
TTGGTCTTGAGCCTACGGATGATCCAGTACGAGCTTGCCTGGGAAAGATG
TANGCAGCTGCAATCTGAGGACGTTGNTGTAAAGGGTAAGGTTGTTGGTG
CAAACAAAAGTGGAGTGGTTGCTGANGTGGAGGCCTTCNNTGGATTGTCC
CTTTCCCCAGATATCATCGAAATCACTGCAGAAGAGCTTCTCGGTAAGAT
CTTCCTCTAAGGTTGTGGGAGGTTGATGAGAACATCTAGGCTTGTCTAAG
TACCGCAGGCCTGGCTGACAGCCAGCACACTAGGAATGGATCAGTGTCAT
TGTACTTACAGAGCTGGAACATATGGGCCTCATGACATGGGGATCATGGC
TCCTCTGCAGCAGAATACCCGACGGGGGTGAATGCT
back to top