EY674916
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY674916 vs. ExPASy Swiss-Prot
Match: GLUP_BACSU (Rhomboid protease gluP OS=Bacillus subtilis GN=gluP PE=1 SV=2) HSP 1 Score: 39.6614 bits (91), Expect = 4.610e-11 Identity = 14/39 (35.90%), Postives = 28/39 (71.79%), Query Frame = 2 Query: 380 GISGNLTSFLHTPEPTVGGTGPVFAIIGALAYLSVPEQR 496 GI+G++ SF+ +P P+ G +G +F +GAL Y+++ ++ Sbjct: 269 GITGSIASFVFSPYPSAGASGAIFGCLGALLYVALSNRK 307 HSP 2 Score: 38.891 bits (89), Expect = 4.610e-11 Identity = 21/45 (46.67%), Postives = 26/45 (57.78%), Query Frame = 3 Query: 114 FLFEIASPIRNSEFGFFSLPLLYGAKINELILVGEWWRLVTPMFL 248 FL EI N+E + +GAK N LI GEWWRL+TP+ L Sbjct: 192 FLLEINGGSTNTE-----TLVAFGAKENSLIAQGEWWRLLTPIVL 231 HSP 3 Score: 28.8758 bits (63), Expect = 4.610e-11 Identity = 14/34 (41.18%), Postives = 19/34 (55.88%), Query Frame = 1 Query: 268 HSGLFHVALSCWALLTFGPQVCKSYGPFTFFLIY 369 H G+ H+A + AL + G V + YG F LIY Sbjct: 232 HIGIAHLAFNTLALWSVGTAVERMYGSGRFLLIY 265 The following BLAST results are available for this feature:
BLAST of EY674916 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 1
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >EY674916 ID=EY674916; Name=EY674916; organism=Citrus sinensis; type=EST; length=1027bpback to top |