EY679508
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY679508 vs. ExPASy Swiss-Prot
Match: ARR11_ARATH (Two-component response regulator ARR11 OS=Arabidopsis thaliana GN=ARR11 PE=1 SV=1) HSP 1 Score: 96.6709 bits (239), Expect = 1.926e-19 Identity = 48/66 (72.73%), Postives = 53/66 (80.30%), Query Frame = 2 Query: 191 FNPAGLRVLVVDDDLAWLKILEKKLKECSYEVPKGGLTKKAKSLLR*RKDGYDIVILDVNMPKMEG 388 F+P GLRVLVVDDD WLKILEK LK+CSYEV GL ++A LLR RKDGYDIVI DVNMP M+G Sbjct: 6 FSPVGLRVLVVDDDPTWLKILEKMLKKCSYEVTTCGLAREALRLLRERKDGYDIVISDVNMPDMDG 71
BLAST of EY679508 vs. ExPASy Swiss-Prot
Match: ARR1_ARATH (Two-component response regulator ARR1 OS=Arabidopsis thaliana GN=ARR1 PE=1 SV=2) HSP 1 Score: 72.0182 bits (175), Expect = 5.079e-12 Identity = 38/64 (59.38%), Postives = 45/64 (70.31%), Query Frame = 2 Query: 197 PAGLRVLVVDDDLAWLKILEKKLKECSYEVPKGGLTKKAKSLLR*RKDGYDIVILDVNMPKMEG 388 P+GLRVLVVDDD L ILE+ L+ C YEV K + A SLLR K G+DIVI DV+MP M+G Sbjct: 34 PSGLRVLVVDDDPTCLMILERMLRTCLYEVTKCNRAEMALSLLRKNKHGFDIVISDVHMPDMDG 97
BLAST of EY679508 vs. ExPASy Swiss-Prot
Match: ARR2_ARATH (Two-component response regulator ARR2 OS=Arabidopsis thaliana GN=ARR2 PE=1 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 4.300e-11 Identity = 37/64 (57.81%), Postives = 43/64 (67.19%), Query Frame = 2 Query: 197 PAGLRVLVVDDDLAWLKILEKKLKECSYEVPKGGLTKKAKSLLR*RKDGYDIVILDVNMPKMEG 388 PA LRVLVVDDD L ILE+ L C Y V K + A SLLR K+G+DIVI DV+MP M+G Sbjct: 25 PANLRVLVVDDDPTCLMILERMLMTCLYRVTKCNRAESALSLLRKNKNGFDIVISDVHMPDMDG 88 The following BLAST results are available for this feature:
BLAST of EY679508 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >EY679508 ID=EY679508; Name=EY679508; organism=Citrus sinensis; type=EST; length=891bpback to top |