DR908482
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of DR908482 vs. ExPASy Swiss-Prot
Match: CYSK2_SCHPO (Cysteine synthase 2 OS=Schizosaccharomyces pombe GN=cys12 PE=2 SV=1) HSP 1 Score: 62.003 bits (149), Expect = 2.764e-14 Identity = 28/39 (71.79%), Postives = 35/39 (89.74%), Query Frame = 1 Query: 1 EAVEMSRFLVKNDGLFLGSSSAMNCVGAVRVAQSLGPGH 117 +AV MSR+LV +DGLF+GSSSA+NCV AVR+A+ LGPGH Sbjct: 316 QAVAMSRYLVTHDGLFVGSSSAVNCVAAVRLAKKLGPGH 354 HSP 2 Score: 36.965 bits (84), Expect = 2.764e-14 Identity = 16/38 (42.11%), Postives = 25/38 (65.79%), Query Frame = 2 Query: 122 IVTILCDSGMRHLSKFYDVHYLSQQGLTP-AAAGLEFL 232 IVT+LCD G RH SK Y+ +L ++ + P + L+F+ Sbjct: 356 IVTLLCDPGSRHFSKLYNEEFLRKKNIVPQVPSSLDFV 393
BLAST of DR908482 vs. ExPASy Swiss-Prot
Match: CYSK_DICDI (Cysteine synthase OS=Dictyostelium discoideum GN=cysK PE=3 SV=1) HSP 1 Score: 60.4622 bits (145), Expect = 8.709e-12 Identity = 26/40 (65.00%), Postives = 35/40 (87.50%), Query Frame = 1 Query: 1 EAVEMSRFLVKNDGLFLGSSSAMNCVGAVRVAQSLGPGHT 120 E V+M+ +L+K+DGLFLG SSA+NCVGAV++A+ LGPG T Sbjct: 300 EGVDMAHYLLKHDGLFLGGSSALNCVGAVKLARKLGPGKT 339 HSP 2 Score: 30.0314 bits (66), Expect = 8.709e-12 Identity = 12/23 (52.17%), Postives = 17/23 (73.91%), Query Frame = 2 Query: 122 IVTILCDSGMRHLSKFYDVHYLS 190 IVT+LCDSG R+ S+ Y +L+ Sbjct: 340 IVTVLCDSGHRYTSRLYSKSWLN 362 The following BLAST results are available for this feature:
BLAST of DR908482 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >DR908482 ID=DR908482; Name=DR908482; organism=Citrus sinensis; type=EST; length=360bpback to top |