DR405977

Overview
NameDR405977
Unique NameDR405977
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length727
Libraries
Library NameType
Mature Juice Sac from Navel Orange in pTriplEx2 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6306 contig Csv1_Contig6306:1..727. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DR405977 vs. ExPASy Swiss-Prot
Match: GALE3_ARATH (UDP-glucose 4-epimerase 3 OS=Arabidopsis thaliana GN=At4g23920 PE=2 SV=1)

HSP 1 Score: 312.383 bits (799), Expect = 1.589e-84
Identity = 146/189 (77.25%), Postives = 171/189 (90.48%), Query Frame = 3
Query:  159 MAKNILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICRDVHRSDSEWKIILLRYFNPVGAHP 725
            MAK++LVTGGAGYIGSHTVLQLL GGY  VVVDN DN+S  ++ +VK+LAG  G+ ++FH++DLRD+ ALE +F++TKF AVIHFAGL+AVGESV+KPLLY++NN++GT+TLLEVMA +GCKNLVFSSSATVYGWPK VPCTEE P+ A NPYGRTKLFIEEICRDVHRSDSEWKIILLRYFNPVGAHP
Sbjct:    1 MAKSVLVTGGAGYIGSHTVLQLLEGGYSAVVVDNYDNSSAASLQRVKKLAGENGNRLSFHQVDLRDRPALEKIFSETKFDAVIHFAGLKAVGESVEKPLLYYNNNIVGTVTLLEVMAQYGCKNLVFSSSATVYGWPKEVPCTEESPISATNPYGRTKLFIEEICRDVHRSDSEWKIILLRYFNPVGAHP 189          
BLAST of DR405977 vs. ExPASy Swiss-Prot
Match: GALE2_ARATH (UDP-glucose 4-epimerase 2 OS=Arabidopsis thaliana GN=At4g10960 PE=2 SV=3)

HSP 1 Score: 311.997 bits (798), Expect = 2.075e-84
Identity = 146/189 (77.25%), Postives = 173/189 (91.53%), Query Frame = 3
Query:  159 MAKNILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICRDVHRSDSEWKIILLRYFNPVGAHP 725
            MA+N+LV+GGAGYIGSHTVLQLLLGGY  VVVDNLDN+S +++ +VK+LA   G+ ++FH++DLRD++ALE +F++TKF AVIHFAGL+AVGESV+KPLLY++NNL+GTITLLEVMA HGCKNLVFSSSATVYG PK VPCTEEFP+ A+NPYGRTKLFIEEICRDV+ SD EWKIILLRYFNPVGAHP
Sbjct:    2 MARNVLVSGGAGYIGSHTVLQLLLGGYSVVVVDNLDNSSAVSLQRVKKLAAEHGERLSFHQVDLRDRSALEKIFSETKFDAVIHFAGLKAVGESVEKPLLYYNNNLVGTITLLEVMAQHGCKNLVFSSSATVYGSPKEVPCTEEFPISALNPYGRTKLFIEEICRDVYGSDPEWKIILLRYFNPVGAHP 190          
BLAST of DR405977 vs. ExPASy Swiss-Prot
Match: GALE2_CYATE (UDP-glucose 4-epimerase GEPI48 OS=Cyamopsis tetragonoloba PE=2 SV=1)

HSP 1 Score: 309.301 bits (791), Expect = 1.345e-83
Identity = 148/188 (78.72%), Postives = 167/188 (88.83%), Query Frame = 3
Query:  162 AKNILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICRDVHRSDSEWKIILLRYFNPVGAHP 725
            ++ +LVTGGAGYIGSHTVLQLLLGG+K VVVDNLDN+SE A+ +VKELAG    N++FHKLDLRD+ ALE +F+ TKF +VIHFAGL+AVGESVQKPLLY+DNNLIGTI L EVMAAHGCK LVFSSSATVYG PK VPCTEEFPL A NPYGRTKL IEEICRD++R++ EWKIILLRYFNPVGAHP
Sbjct:    3 SQTVLVTGGAGYIGSHTVLQLLLGGFKAVVVDNLDNSSETAIHRVKELAGKFAGNLSFHKLDLRDRDALEKIFSSTKFDSVIHFAGLKAVGESVQKPLLYYDNNLIGTIVLFEVMAAHGCKKLVFSSSATVYGLPKEVPCTEEFPLSAANPYGRTKLIIEEICRDIYRAEQEWKIILLRYFNPVGAHP 190          
BLAST of DR405977 vs. ExPASy Swiss-Prot
Match: GALE1_PEA (UDP-glucose 4-epimerase OS=Pisum sativum GN=GALE PE=2 SV=1)

HSP 1 Score: 244.588 bits (623), Expect = 4.068e-64
Identity = 117/188 (62.23%), Postives = 148/188 (78.72%), Query Frame = 3
Query:  162 AKNILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAG-NQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICRDVHRSDSEWKIILLRYFNPVGAH 722
            ++ ILVTG AG+IG+HTV+QLL  G+   ++DN DN+   AV +V+E+ G N   N+ F   DLR+K  LE LF+K+KF AVIHFAGL+AVGESV+ P  YFDNNL+GTI L EVMA H CK +VFSSSATVYG P+ +PC E+F L+AMNPYGRTKLF+EEI RD+ +++ EW+I+LLRYFNPVGAH
Sbjct:    5 SQKILVTGSAGFIGTHTVVQLLNNGFNVSIIDNFDNSVMEAVERVREVVGSNLSQNLEFTLGDLRNKDDLEKLFSKSKFDAVIHFAGLKAVGESVENPRRYFDNNLVGTINLYEVMAKHNCKKMVFSSSATVYGQPEKIPCVEDFKLQAMNPYGRTKLFLEEIARDIQKAEPEWRIVLLRYFNPVGAH 192          
BLAST of DR405977 vs. ExPASy Swiss-Prot
Match: GALE1_ARATH (UDP-glucose 4-epimerase 1 OS=Arabidopsis thaliana GN=At1g12780 PE=1 SV=2)

HSP 1 Score: 242.276 bits (617), Expect = 2.019e-63
Identity = 117/190 (61.58%), Postives = 150/190 (78.95%), Query Frame = 3
Query:  156 SMAKNILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAG-NQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICRDVHRSDSEWKIILLRYFNPVGAH 722
            S+ +NILVTGGAG+IG+HTV+QLL  G+K  ++DN DN+   AV +V+EL G +    + F+  DLR+K  +E LF+K +F AVIHFAGL+AVGESV+ P  YFDNNL+GTI L E MA + CK +VFSSSATVYG P+ +PC E+F L+AMNPYGRTKLF+EEI RD+ +++ EW+IILLRYFNPVGAH
Sbjct:    4 SVEQNILVTGGAGFIGTHTVVQLLKDGFKVSIIDNFDNSVIEAVDRVRELVGPDLSKKLDFNLGDLRNKGDIEKLFSKQRFDAVIHFAGLKAVGESVENPRRYFDNNLVGTINLYETMAKYNCKMMVFSSSATVYGQPEKIPCMEDFELKAMNPYGRTKLFLEEIARDIQKAEPEWRIILLRYFNPVGAH 193          
BLAST of DR405977 vs. ExPASy Swiss-Prot
Match: GALE1_CYATE (UDP-glucose 4-epimerase GEPI42 OS=Cyamopsis tetragonoloba PE=2 SV=1)

HSP 1 Score: 223.787 bits (569), Expect = 7.432e-58
Identity = 113/196 (57.65%), Postives = 143/196 (72.96%), Query Frame = 3
Query:  138 LVSPLDSMAKNILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQ-GDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICRDVHRSDSEWKIILLRYFNPVGAH 722
            +VS   +  + ILVTGGAG+IGSHTV+QLL  G+   ++DNL N+   AV +V+ L G     N+ FH  DLR+   L+ LF+KTKF AVIHFAGL+ VGESV  P  Y+DNNL+ TI L +VM+   CK LV SSSATVYG P  +PC E+  L AMNPYGR+KLF+EE+ RD+ R+++EW+IILLRYFNPVGAH
Sbjct:    1 MVSSRMASGETILVTGGAGFIGSHTVVQLLKQGFHVSIIDNLYNSVIDAVHRVRLLVGPLLSSNLHFHHGDLRNIHDLDILFSKTKFDAVIHFAGLKGVGESVLNPSNYYDNNLVATINLFQVMSKFNCKKLVISSSATVYGQPDQIPCVEDSNLHAMNPYGRSKLFVEEVARDIQRAEAEWRIILLRYFNPVGAH 196          
BLAST of DR405977 vs. ExPASy Swiss-Prot
Match: GALE_BACSU (UDP-glucose 4-epimerase OS=Bacillus subtilis GN=galE PE=3 SV=1)

HSP 1 Score: 223.402 bits (568), Expect = 9.706e-58
Identity = 109/185 (58.92%), Postives = 141/185 (76.22%), Query Frame = 3
Query:  171 ILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICRDVHRSDSEWKIILLRYFNPVGAHP 725
            ILVTGGAGYIGSHT ++LL  GY+ VV+DNL N+S  A+ +VKE+ G    ++TF++ DL D+ A++++FA+ +  AVIHFAGL+AVGESV  PL Y+ NNL GT  L E M  +G K +VFSSSATVYG P+  P TE+FPL A NPYG+TKL +E+I RD+H +D+EW + LLRYFNP GAHP
Sbjct:    3 ILVTGGAGYIGSHTCVELLNSGYEIVVLDNLSNSSAEALNRVKEITGK---DLTFYEADLLDREAVDSVFAENEIEAVIHFAGLKAVGESVAIPLKYYHNNLTGTFILCEAMEKYGVKKIVFSSSATVYGVPETSPITEDFPLGATNPYGQTKLMLEQILRDLHTADNEWSVALLRYFNPFGAHP 184          
BLAST of DR405977 vs. ExPASy Swiss-Prot
Match: GALE_DICDI (UDP-glucose 4-epimerase OS=Dictyostelium discoideum GN=galE PE=1 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 1.550e-55
Identity = 107/195 (54.87%), Postives = 141/195 (72.31%), Query Frame = 3
Query:  141 VSPLDSMAKNILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICRDVHRSDSEWKIILLRYFNPVGAHP 725
            + P+D     I+VTGGAGYIGSHTV++L+  GY  V+VDNL N+S  A+ +V+ + G +   + FH +D+ ++ AL+ +F      +VIHFAGL+AVGES + PL Y++NN+ GT+TLL +M  H  K LVFSSSATVYG P  VP TE+FPL A NPYGRTKL++E I +D+  SD EW  I+LRYFNPVGAHP
Sbjct:    1 MEPIDD---RIMVTGGAGYIGSHTVIELIEAGYTPVIVDNLSNSSLEAIKRVESITGKE---IEFHHVDIMNEKALDEIFETGNIRSVIHFAGLKAVGESNKLPLKYYNNNIAGTLTLLNLMDKHRVKKLVFSSSATVYGDPHTVPITEDFPLSATNPYGRTKLYVEGILQDLCASDPEWNCIMLRYFNPVGAHP 189          
BLAST of DR405977 vs. ExPASy Swiss-Prot
Match: GALE_MOUSE (UDP-glucose 4-epimerase OS=Mus musculus GN=Gale PE=2 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 8.503e-54
Identity = 111/193 (57.51%), Postives = 139/193 (72.02%), Query Frame = 3
Query:  165 KNILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASE------IAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPL-EAMNPYGRTKLFIEEICRDVHRSDSEWKIILLRYFNPVGAH 722
            + +LVTGGAGYIGSHTVL+LL  GY  VV+DN  NA         ++ +V+EL G    ++ F ++D+ D+AAL+ LF K  F AVIHFAGL+AVGESVQKPL Y+  NL GTI LLE+M AHG KNLVFSSSATVYG P+ +P  E  P     NPYG++K FIEE+ RD+ R+D+ W  +LLRYFNP+GAH
Sbjct:    2 EKVLVTGGAGYIGSHTVLELLEAGYSPVVIDNFHNAIRGEDSMPESLRRVQELTGR---SVEFEEMDILDQAALQHLFKKHSFKAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMRAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCRADTAWNAVLLRYFNPIGAH 191          
BLAST of DR405977 vs. ExPASy Swiss-Prot
Match: GALE_PONAB (UDP-glucose 4-epimerase OS=Pongo abelii GN=GALE PE=2 SV=1)

HSP 1 Score: 208.379 bits (529), Expect = 3.231e-53
Identity = 111/195 (56.92%), Postives = 138/195 (70.77%), Query Frame = 3
Query:  159 MAKNILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASE------IAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPL-EAMNPYGRTKLFIEEICRDVHRSDSEWKIILLRYFNPVGAH 722
            MA+ +LVTGGAGYIGSHTVL+LL  GY  VV+DN  NA         ++ +V+EL G    ++ F ++D+ D+ AL+ LF K  F AVIHFAGL+AVGESVQKPL Y+  NL GTI LLE+M AHG KNLVFSSSATVYG P+ +P  E  P     NPYG++K FIEE+ RD+ ++D  W  +LLRYFNP GAH
Sbjct:    1 MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGR---SVEFEEMDILDQGALQRLFKKHSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAH 192          
The following BLAST results are available for this feature:
BLAST of DR405977 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 63
Match NameE-valueIdentityDescription
GALE3_ARATH1.589e-8477.25UDP-glucose 4-epimerase 3 OS=Arabidopsis thaliana ... [more]
GALE2_ARATH2.075e-8477.25UDP-glucose 4-epimerase 2 OS=Arabidopsis thaliana ... [more]
GALE2_CYATE1.345e-8378.72UDP-glucose 4-epimerase GEPI48 OS=Cyamopsis tetrag... [more]
GALE1_PEA4.068e-6462.23UDP-glucose 4-epimerase OS=Pisum sativum GN=GALE P... [more]
GALE1_ARATH2.019e-6361.58UDP-glucose 4-epimerase 1 OS=Arabidopsis thaliana ... [more]
GALE1_CYATE7.432e-5857.65UDP-glucose 4-epimerase GEPI42 OS=Cyamopsis tetrag... [more]
GALE_BACSU9.706e-5858.92UDP-glucose 4-epimerase OS=Bacillus subtilis GN=ga... [more]
GALE_DICDI1.550e-5554.87UDP-glucose 4-epimerase OS=Dictyostelium discoideu... [more]
GALE_MOUSE8.503e-5457.51UDP-glucose 4-epimerase OS=Mus musculus GN=Gale PE... [more]
GALE_PONAB3.231e-5356.92UDP-glucose 4-epimerase OS=Pongo abelii GN=GALE PE... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCSAJ-PNP1248F19 Mature Juice Sac from Navel Orange in pTriplEx2 vector Citrus sinensis cDNA clone CSAJ-PNP1248F19 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR405977 ID=DR405977|Name=DR405977|organism=Citrus sinensis|type=EST|length=727bp
GGGGGTCAGTTTCATTTTTTTCTTTTCCTTTAAATTTCTCTGAGCGAGGC
CAAGCCCAAGTCTCATCACTTCCTTCGTAATTCCCCCGTTTCTTCAAATT
TTCGTGTACTTTGTGCCCTTTTTTTTGGTTCTTCTGATTGGTCTCTCCGT
TAGACTCCATGGCTAAGAACATTTTGGTGACCGGTGGCGCCGGTTACATT
GGAAGCCACACCGTGCTTCAGTTGCTGTTAGGCGGTTACAAAACTGTCGT
CGTCGACAATCTCGATAATGCCTCGGAAATCGCCGTCGCAAAAGTCAAAG
AACTCGCTGGCAATCAAGGCGACAACATGACCTTTCATAAGTTGGATCTC
CGGGACAAAGCAGCGCTGGAAGCATTGTTTGCCAAAACAAAGTTCGGTGC
TGTCATCCATTTTGCTGGACTGGAAGCAGTTGGTGAAAGTGTGCAGAAAC
CATTGCTGTATTTTGACAACAATCTTATTGGAACCATAACTCTCTTGGAA
GTTATGGCAGCACATGGCTGCAAAAATCTGGTCTTTTCATCATCAGCTAC
TGTTTATGGCTGGCCAAAGGTGGTTCCGTGTACAGAAGAGTTCCCGTTAG
AGGCAATGAACCCTTATGGACGTACCAAGCTTTTCATTGAAGAGATTTGC
CGTGATGTCCACCGCTCAGACTCTGAATGGAAGATCATATTGCTGAGATA
TTTCAATCCTGTTGGTGCACATCCAAG
back to top