DR405962

Overview
NameDR405962
Unique NameDR405962
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length729
Libraries
Library NameType
Mature Juice Sac from Navel Orange in pTriplEx2 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6306 contig Csv1_Contig6306:1..728. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: GALE3_ARATH (UDP-glucose 4-epimerase 3 OS=Arabidopsis thaliana GN=At4g23920 PE=2 SV=1)

HSP 1 Score: 283.108 bits (723), Expect = 8.848e-78
Identity = 132/175 (75.43%), Postives = 157/175 (89.71%), Query Frame = 3
Query:  159 MAKNILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICRDVHRSDSEWK 683
            MAK++LVTGGAGYIGSHTVLQLL GGY  VVVDN DN+S  ++ +VK+LAG  G+ ++FH++DLRD+ ALE +F++TKF AVIHFAGL+AVGESV+KPLLY++NN++GT+TLLEVMA +GCKNLVFSSSATVYGWPK VPCTEE P+ A NPYGRTKLFIEEICRDVHRSDSEWK
Sbjct:    1 MAKSVLVTGGAGYIGSHTVLQLLEGGYSAVVVDNYDNSSAASLQRVKKLAGENGNRLSFHQVDLRDRPALEKIFSETKFDAVIHFAGLKAVGESVEKPLLYYNNNIVGTVTLLEVMAQYGCKNLVFSSSATVYGWPKEVPCTEESPISATNPYGRTKLFIEEICRDVHRSDSEWK 175          

HSP 2 Score: 29.261 bits (64), Expect = 8.848e-78
Identity = 13/16 (81.25%), Postives = 13/16 (81.25%), Query Frame = 1
Query:  682 KIILLRYFNPVXXXPS 729
            KIILLRYFNPV   PS
Sbjct:  175 KIILLRYFNPVGAHPS 190          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: GALE2_ARATH (UDP-glucose 4-epimerase 2 OS=Arabidopsis thaliana GN=At4g10960 PE=2 SV=3)

HSP 1 Score: 282.722 bits (722), Expect = 1.154e-77
Identity = 132/175 (75.43%), Postives = 159/175 (90.86%), Query Frame = 3
Query:  159 MAKNILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICRDVHRSDSEWK 683
            MA+N+LV+GGAGYIGSHTVLQLLLGGY  VVVDNLDN+S +++ +VK+LA   G+ ++FH++DLRD++ALE +F++TKF AVIHFAGL+AVGESV+KPLLY++NNL+GTITLLEVMA HGCKNLVFSSSATVYG PK VPCTEEFP+ A+NPYGRTKLFIEEICRDV+ SD EWK
Sbjct:    2 MARNVLVSGGAGYIGSHTVLQLLLGGYSVVVVDNLDNSSAVSLQRVKKLAAEHGERLSFHQVDLRDRSALEKIFSETKFDAVIHFAGLKAVGESVEKPLLYYNNNLVGTITLLEVMAQHGCKNLVFSSSATVYGSPKEVPCTEEFPISALNPYGRTKLFIEEICRDVYGSDPEWK 176          

HSP 2 Score: 29.261 bits (64), Expect = 1.154e-77
Identity = 13/16 (81.25%), Postives = 13/16 (81.25%), Query Frame = 1
Query:  682 KIILLRYFNPVXXXPS 729
            KIILLRYFNPV   PS
Sbjct:  176 KIILLRYFNPVGAHPS 191          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: GALE2_CYATE (UDP-glucose 4-epimerase GEPI48 OS=Cyamopsis tetragonoloba PE=2 SV=1)

HSP 1 Score: 280.026 bits (715), Expect = 7.410e-77
Identity = 134/174 (77.01%), Postives = 153/174 (87.93%), Query Frame = 3
Query:  162 AKNILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICRDVHRSDSEWK 683
            ++ +LVTGGAGYIGSHTVLQLLLGG+K VVVDNLDN+SE A+ +VKELAG    N++FHKLDLRD+ ALE +F+ TKF +VIHFAGL+AVGESVQKPLLY+DNNLIGTI L EVMAAHGCK LVFSSSATVYG PK VPCTEEFPL A NPYGRTKL IEEICRD++R++ EWK
Sbjct:    3 SQTVLVTGGAGYIGSHTVLQLLLGGFKAVVVDNLDNSSETAIHRVKELAGKFAGNLSFHKLDLRDRDALEKIFSSTKFDSVIHFAGLKAVGESVQKPLLYYDNNLIGTIVLFEVMAAHGCKKLVFSSSATVYGLPKEVPCTEEFPLSAANPYGRTKLIIEEICRDIYRAEQEWK 176          

HSP 2 Score: 29.261 bits (64), Expect = 7.410e-77
Identity = 13/16 (81.25%), Postives = 13/16 (81.25%), Query Frame = 1
Query:  682 KIILLRYFNPVXXXPS 729
            KIILLRYFNPV   PS
Sbjct:  176 KIILLRYFNPVGAHPS 191          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: GALE1_PEA (UDP-glucose 4-epimerase OS=Pisum sativum GN=GALE PE=2 SV=1)

HSP 1 Score: 218.394 bits (555), Expect = 4.998e-57
Identity = 105/175 (60.00%), Postives = 135/175 (77.14%), Query Frame = 3
Query:  162 AKNILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAG-NQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICRDVHRSDSEWK 683
            ++ ILVTG AG+IG+HTV+QLL  G+   ++DN DN+   AV +V+E+ G N   N+ F   DLR+K  LE LF+K+KF AVIHFAGL+AVGESV+ P  YFDNNL+GTI L EVMA H CK +VFSSSATVYG P+ +PC E+F L+AMNPYGRTKLF+EEI RD+ +++ EW+
Sbjct:    5 SQKILVTGSAGFIGTHTVVQLLNNGFNVSIIDNFDNSVMEAVERVREVVGSNLSQNLEFTLGDLRNKDDLEKLFSKSKFDAVIHFAGLKAVGESVENPRRYFDNNLVGTINLYEVMAKHNCKKMVFSSSATVYGQPEKIPCVEDFKLQAMNPYGRTKLFLEEIARDIQKAEPEWR 179          

HSP 2 Score: 24.6386 bits (52), Expect = 4.998e-57
Identity = 9/11 (81.82%), Postives = 11/11 (100.00%), Query Frame = 1
Query:  682 KIILLRYFNPV 714
            +I+LLRYFNPV
Sbjct:  179 RIVLLRYFNPV 189          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: GALE1_ARATH (UDP-glucose 4-epimerase 1 OS=Arabidopsis thaliana GN=At1g12780 PE=1 SV=2)

HSP 1 Score: 215.698 bits (548), Expect = 2.454e-56
Identity = 104/177 (58.76%), Postives = 137/177 (77.40%), Query Frame = 3
Query:  156 SMAKNILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAG-NQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICRDVHRSDSEWK 683
            S+ +NILVTGGAG+IG+HTV+QLL  G+K  ++DN DN+   AV +V+EL G +    + F+  DLR+K  +E LF+K +F AVIHFAGL+AVGESV+ P  YFDNNL+GTI L E MA + CK +VFSSSATVYG P+ +PC E+F L+AMNPYGRTKLF+EEI RD+ +++ EW+
Sbjct:    4 SVEQNILVTGGAGFIGTHTVVQLLKDGFKVSIIDNFDNSVIEAVDRVRELVGPDLSKKLDFNLGDLRNKGDIEKLFSKQRFDAVIHFAGLKAVGESVENPRRYFDNNLVGTINLYETMAKYNCKMMVFSSSATVYGQPEKIPCMEDFELKAMNPYGRTKLFLEEIARDIQKAEPEWR 180          

HSP 2 Score: 25.0238 bits (53), Expect = 2.454e-56
Identity = 10/11 (90.91%), Postives = 11/11 (100.00%), Query Frame = 1
Query:  682 KIILLRYFNPV 714
            +IILLRYFNPV
Sbjct:  180 RIILLRYFNPV 190          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: GALE1_CYATE (UDP-glucose 4-epimerase GEPI42 OS=Cyamopsis tetragonoloba PE=2 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 8.254e-51
Identity = 100/183 (54.64%), Postives = 130/183 (71.04%), Query Frame = 3
Query:  138 LVSPLDSMAKNILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQ-GDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICRDVHRSDSEWK 683
            +VS   +  + ILVTGGAG+IGSHTV+QLL  G+   ++DNL N+   AV +V+ L G     N+ FH  DLR+   L+ LF+KTKF AVIHFAGL+ VGESV  P  Y+DNNL+ TI L +VM+   CK LV SSSATVYG P  +PC E+  L AMNPYGR+KLF+EE+ RD+ R+++EW+
Sbjct:    1 MVSSRMASGETILVTGGAGFIGSHTVVQLLKQGFHVSIIDNLYNSVIDAVHRVRLLVGPLLSSNLHFHHGDLRNIHDLDILFSKTKFDAVIHFAGLKGVGESVLNPSNYYDNNLVATINLFQVMSKFNCKKLVISSSATVYGQPDQIPCVEDSNLHAMNPYGRSKLFVEEVARDIQRAEAEWR 183          

HSP 2 Score: 25.0238 bits (53), Expect = 8.254e-51
Identity = 10/11 (90.91%), Postives = 11/11 (100.00%), Query Frame = 1
Query:  682 KIILLRYFNPV 714
            +IILLRYFNPV
Sbjct:  183 RIILLRYFNPV 193          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: GALE_BACSU (UDP-glucose 4-epimerase OS=Bacillus subtilis GN=galE PE=3 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 1.076e-50
Identity = 99/178 (55.62%), Postives = 131/178 (73.60%), Query Frame = 3
Query:  171 ILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICRDVHRSDSEWKDHIAEIF 704
            ILVTGGAGYIGSHT ++LL  GY+ VV+DNL N+S  A+ +VKE+ G    ++TF++ DL D+ A++++FA+ +  AVIHFAGL+AVGESV  PL Y+ NNL GT  L E M  +G K +VFSSSATVYG P+  P TE+FPL A NPYG+TKL +E+I RD+H +D+EW   +   F
Sbjct:    3 ILVTGGAGYIGSHTCVELLNSGYEIVVLDNLSNSSAEALNRVKEITGK---DLTFYEADLLDREAVDSVFAENEIEAVIHFAGLKAVGESVAIPLKYYHNNLTGTFILCEAMEKYGVKKIVFSSSATVYGVPETSPITEDFPLGATNPYGQTKLMLEQILRDLHTADNEWSVALLRYF 177          

HSP 2 Score: 23.0978 bits (48), Expect = 1.076e-50
Identity = 9/15 (60.00%), Postives = 10/15 (66.67%), Query Frame = 1
Query:  685 IILLRYFNPVXXXPS 729
            + LLRYFNP    PS
Sbjct:  171 VALLRYFNPFGAHPS 185          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: GALE_DICDI (UDP-glucose 4-epimerase OS=Dictyostelium discoideum GN=galE PE=1 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 1.654e-48
Identity = 95/180 (52.78%), Postives = 128/180 (71.11%), Query Frame = 3
Query:  141 VSPLDSMAKNILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICRDVHRSDSEW 680
            + P+D     I+VTGGAGYIGSHTV++L+  GY  V+VDNL N+S  A+ +V+ + G +   + FH +D+ ++ AL+ +F      +VIHFAGL+AVGES + PL Y++NN+ GT+TLL +M  H  K LVFSSSATVYG P  VP TE+FPL A NPYGRTKL++E I +D+  SD EW
Sbjct:    1 MEPIDD---RIMVTGGAGYIGSHTVIELIEAGYTPVIVDNLSNSSLEAIKRVESITGKE---IEFHHVDIMNEKALDEIFETGNIRSVIHFAGLKAVGESNKLPLKYYNNNIAGTLTLLNLMDKHRVKKLVFSSSATVYGDPHTVPITEDFPLSATNPYGRTKLYVEGILQDLCASDPEW 174          

HSP 2 Score: 25.0238 bits (53), Expect = 1.654e-48
Identity = 10/14 (71.43%), Postives = 11/14 (78.57%), Query Frame = 1
Query:  688 ILLRYFNPVXXXPS 729
            I+LRYFNPV   PS
Sbjct:  177 IMLRYFNPVGAHPS 190          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: GALE_MOUSE (UDP-glucose 4-epimerase OS=Mus musculus GN=Gale PE=2 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 8.799e-47
Identity = 102/187 (54.55%), Postives = 129/187 (68.98%), Query Frame = 3
Query:  165 KNILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASE------IAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPL-EAMNPYGRTKLFIEEICRDVHRSDSEWKDHIAEIF 704
            + +LVTGGAGYIGSHTVL+LL  GY  VV+DN  NA         ++ +V+EL G    ++ F ++D+ D+AAL+ LF K  F AVIHFAGL+AVGESVQKPL Y+  NL GTI LLE+M AHG KNLVFSSSATVYG P+ +P  E  P     NPYG++K FIEE+ RD+ R+D+ W   +   F
Sbjct:    2 EKVLVTGGAGYIGSHTVLELLEAGYSPVVIDNFHNAIRGEDSMPESLRRVQELTGR---SVEFEEMDILDQAALQHLFKKHSFKAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMRAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCRADTAWNAVLLRYF 185          

HSP 2 Score: 21.9422 bits (45), Expect = 8.799e-47
Identity = 7/9 (77.78%), Postives = 9/9 (100.00%), Query Frame = 1
Query:  688 ILLRYFNPV 714
            +LLRYFNP+
Sbjct:  180 VLLRYFNPI 188          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: GALE_PONAB (UDP-glucose 4-epimerase OS=Pongo abelii GN=GALE PE=2 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 1.731e-46
Identity = 102/189 (53.97%), Postives = 129/189 (68.25%), Query Frame = 3
Query:  159 MAKNILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASE------IAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPL-EAMNPYGRTKLFIEEICRDVHRSDSEWKDHIAEIF 704
            MA+ +LVTGGAGYIGSHTVL+LL  GY  VV+DN  NA         ++ +V+EL G    ++ F ++D+ D+ AL+ LF K  F AVIHFAGL+AVGESVQKPL Y+  NL GTI LLE+M AHG KNLVFSSSATVYG P+ +P  E  P     NPYG++K FIEE+ RD+ ++D  W   +   F
Sbjct:    1 MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGR---SVEFEEMDILDQGALQRLFKKHSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYF 186          
The following BLAST results are available for this feature:
BLAST of DR405962 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 63
Match NameE-valueIdentityDescription
GALE3_ARATH8.848e-7875.43UDP-glucose 4-epimerase 3 OS=Arabidopsis thaliana ... [more]
GALE2_ARATH1.154e-7775.43UDP-glucose 4-epimerase 2 OS=Arabidopsis thaliana ... [more]
GALE2_CYATE7.410e-7777.01UDP-glucose 4-epimerase GEPI48 OS=Cyamopsis tetrag... [more]
GALE1_PEA4.998e-5760.00UDP-glucose 4-epimerase OS=Pisum sativum GN=GALE P... [more]
GALE1_ARATH2.454e-5658.76UDP-glucose 4-epimerase 1 OS=Arabidopsis thaliana ... [more]
GALE1_CYATE8.254e-5154.64UDP-glucose 4-epimerase GEPI42 OS=Cyamopsis tetrag... [more]
GALE_BACSU1.076e-5055.62UDP-glucose 4-epimerase OS=Bacillus subtilis GN=ga... [more]
GALE_DICDI1.654e-4852.78UDP-glucose 4-epimerase OS=Dictyostelium discoideu... [more]
GALE_MOUSE8.799e-4754.55UDP-glucose 4-epimerase OS=Mus musculus GN=Gale PE... [more]
GALE_PONAB1.731e-4653.97UDP-glucose 4-epimerase OS=Pongo abelii GN=GALE PE... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCSAJ-PNP1248E24 Mature Juice Sac from Navel Orange in pTriplEx2 vector Citrus sinensis cDNA clone CSAJ-PNP1248E24 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR405962 ID=DR405962|Name=DR405962|organism=Citrus sinensis|type=EST|length=729bp
GGGGGTCAGTTTCATTTTTTTCTTTTCCTTTAAATTTCTCTGAGCGAGGC
CAAGCCCAAGTCTCATCACTTCCTTCGTAATTCCCCCGTTTCTTCAAATT
TTCGTGTACTTTGTGCCCTTTTTTTTGGTTCTTCTGATTGGTCTCTCCGT
TAGACTCCATGGCTAAGAACATTTTGGTGACCGGTGGCGCCGGTTACATT
GGAAGCCACACCGTGCTTCAGTTGCTGTTAGGCGGTTACAAAACTGTCGT
CGTCGACAATCTCGATAATGCCTCGGAAATCGCCGTCGCAAAAGTCAAAG
AACTCGCTGGCAATCAAGGCGACAACATGACCTTTCATAAGTTGGATCTC
CGGGACAAAGCAGCGCTGGAAGCATTGTTTGCCAAAACAAAGTTCGGTGC
TGTCATCCATTTTGCTGGACTGGAAGCAGTTGGTGAAAGTGTGCAGAAAC
CATTGCTGTATTTTGACAACAATCTTATTGGAACCATAACTCTCTTGGAA
GTTATGGCAGCACATGGCTGCAAAAATCTGGTCTTTTCATCATCAGCTAC
TGTTTATGGCTGGCCAAAGGTGGTTCCGTGTACAGAAGAGTTCCCGTTAG
AGGCAATGAACCCTTATGGACGTACCAAGCTTTTCATTGAAGAGATTTGC
CGTGATGTCCACCGCTCAGACTCTGAATGGAAAGATCATATTGCTGAGAT
ATTTCAATCCTGTTGNNNNNNATCCAAGT
back to top