CX070246
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX070246 vs. ExPASy Swiss-Prot
Match: E1310_ARATH (Glucan endo-1,3-beta-glucosidase 10 OS=Arabidopsis thaliana GN=At5g42100 PE=1 SV=1) HSP 1 Score: 88.9669 bits (219), Expect = 3.472e-17 Identity = 38/46 (82.61%), Postives = 42/46 (91.30%), Query Frame = 2 Query: 8 TPMRPNCDLNIYVFALFNENLKPGPTSERNYGLFKPDGSPAYSLGI 145 TP+RP CDL I+VFALFNEN+KPGPTSERNYGLF PDG+P YSLGI Sbjct: 303 TPIRPECDLTIFVFALFNENMKPGPTSERNYGLFNPDGTPVYSLGI 348
BLAST of CX070246 vs. ExPASy Swiss-Prot
Match: E1311_ARATH (Glucan endo-1,3-beta-glucosidase 11 OS=Arabidopsis thaliana GN=At1g32860 PE=1 SV=1) HSP 1 Score: 87.4261 bits (215), Expect = 1.010e-16 Identity = 39/45 (86.67%), Postives = 43/45 (95.56%), Query Frame = 2 Query: 8 TPMRPNCDLNIYVFALFNENLKPGPTSERNYGLFKPDGSPAYSLG 142 TP++PN DL+IYVFALFNENLKPGPTSERNYGLFKPDG+ AYSLG Sbjct: 304 TPLKPNNDLSIYVFALFNENLKPGPTSERNYGLFKPDGTQAYSLG 348
BLAST of CX070246 vs. ExPASy Swiss-Prot
Match: E1314_ARATH (Glucan endo-1,3-beta-glucosidase 14 OS=Arabidopsis thaliana GN=At2g27500/F10A12.18 PE=1 SV=2) HSP 1 Score: 77.0258 bits (188), Expect = 1.365e-13 Identity = 32/48 (66.67%), Postives = 40/48 (83.33%), Query Frame = 2 Query: 2 KGTPMRPNCDLNIYVFALFNENLKPGPTSERNYGLFKPDGSPAYSLGI 145 KGTP + + +++YVFALFNENLKPGP SERNYGLF PDG P Y++G+ Sbjct: 301 KGTPAKQSVPIDVYVFALFNENLKPGPVSERNYGLFYPDGKPVYNVGM 348 The following BLAST results are available for this feature:
BLAST of CX070246 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX070246 ID=CX070246; Name=CX070246; organism=Citrus sinensis; type=EST; length=811bpback to top |