CX070179
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX070179 vs. ExPASy Swiss-Prot
Match: GSH1_SOLLC (Glutamate--cysteine ligase, chloroplastic OS=Solanum lycopersicum GN=GSH1 PE=2 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 2.128e-13 Identity = 33/39 (84.62%), Postives = 38/39 (97.44%), Query Frame = 2 Query: 2 LNEVAEVVRTGVTPAEKLLDMYHGKWRESVDPVFEELLY 118 LNEVAEVV+TGVTPAEKLL++YHGKW +SVDP+FEELLY Sbjct: 485 LNEVAEVVKTGVTPAEKLLELYHGKWGQSVDPIFEELLY 523
BLAST of CX070179 vs. ExPASy Swiss-Prot
Match: GSH1_TOBAC (Glutamate--cysteine ligase, chloroplastic OS=Nicotiana tabacum GN=GSH1 PE=2 SV=2) HSP 1 Score: 74.3294 bits (181), Expect = 3.630e-13 Identity = 34/39 (87.18%), Postives = 36/39 (92.31%), Query Frame = 2 Query: 2 LNEVAEVVRTGVTPAEKLLDMYHGKWRESVDPVFEELLY 118 LNEV EVVRTGVTPAEKLL++YHGKW SVDPVFEELLY Sbjct: 484 LNEVTEVVRTGVTPAEKLLELYHGKWGRSVDPVFEELLY 522
BLAST of CX070179 vs. ExPASy Swiss-Prot
Match: GSH1_MEDTR (Glutamate--cysteine ligase, chloroplastic OS=Medicago truncatula GN=GSH1 PE=2 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.168e-11 Identity = 31/39 (79.49%), Postives = 36/39 (92.31%), Query Frame = 2 Query: 2 LNEVAEVVRTGVTPAEKLLDMYHGKWRESVDPVFEELLY 118 LN VAEVVRTGVTPAE+LL++YHGKW +SVD VF+ELLY Sbjct: 470 LNAVAEVVRTGVTPAERLLELYHGKWEQSVDHVFDELLY 508
BLAST of CX070179 vs. ExPASy Swiss-Prot
Match: GSH1_ARATH (Glutamate--cysteine ligase, chloroplastic OS=Arabidopsis thaliana GN=GSH1 PE=1 SV=2) HSP 1 Score: 68.9366 bits (167), Expect = 1.525e-11 Identity = 32/39 (82.05%), Postives = 36/39 (92.31%), Query Frame = 2 Query: 2 LNEVAEVVRTGVTPAEKLLDMYHGKWRESVDPVFEELLY 118 LN V EVVRTGVTPAEKLL+MY+G+W +SVDPVFEELLY Sbjct: 484 LNAVDEVVRTGVTPAEKLLEMYNGEWGQSVDPVFEELLY 522
BLAST of CX070179 vs. ExPASy Swiss-Prot
Match: GSH1_BRAJU (Glutamate--cysteine ligase, chloroplastic OS=Brassica juncea GN=GSH1 PE=1 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 7.568e-11 Identity = 30/39 (76.92%), Postives = 35/39 (89.74%), Query Frame = 2 Query: 2 LNEVAEVVRTGVTPAEKLLDMYHGKWRESVDPVFEELLY 118 LN V EVVRTGVTPAE LL+MY+G+W +SVDPVF+ELLY Sbjct: 476 LNAVTEVVRTGVTPAENLLEMYNGEWGQSVDPVFQELLY 514 The following BLAST results are available for this feature:
BLAST of CX070179 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 5
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX070179 ID=CX070179; Name=CX070179; organism=Citrus sinensis; type=EST; length=515bpback to top |