CX069428
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CX069428 vs. ExPASy Swiss-Prot
Match: GAT25_ARATH (GATA transcription factor 25 OS=Arabidopsis thaliana GN=TIFY2A PE=2 SV=1) HSP 1 Score: 87.8113 bits (216), Expect = 6.916e-17 Identity = 43/68 (63.24%), Postives = 49/68 (72.06%), Query Frame = -1 Query: 540 CQHCGISEKLTPAMRRGPAGPRTLCNACGLMWANKGTLRDLTKG----ARNICFEQHE---LETSSDI 722 C+HCGI EK TP MRRGPAGPRTLCNACGLMWANKG RDL+K A+N+ ++E LET I Sbjct: 223 CRHCGIGEKSTPMMRRGPAGPRTLCNACGLMWANKGAFRDLSKASPQTAQNLPLNKNEDANLETDHQI 290
BLAST of CX069428 vs. ExPASy Swiss-Prot
Match: GAT27_ARATH (GATA transcription factor 27 OS=Arabidopsis thaliana GN=TIFY2B PE=2 SV=2) HSP 1 Score: 87.4261 bits (215), Expect = 9.032e-17 Identity = 37/44 (84.09%), Postives = 40/44 (90.91%), Query Frame = -1 Query: 594 ICQHCGISEKLTPAMRRGPAGPRTLCNACGLMWANKGTLRDLTK 725 +C+HCG SEK TP MRRGP GPRTLCNACGLMWANKGTLRDL+K Sbjct: 218 LCRHCGTSEKSTPMMRRGPDGPRTLCNACGLMWANKGTLRDLSK 261
BLAST of CX069428 vs. ExPASy Swiss-Prot
Match: GAT26_ARATH (GATA transcription factor 26 OS=Arabidopsis thaliana GN=TIFY1 PE=2 SV=2) HSP 1 Score: 84.3445 bits (207), Expect = 7.646e-16 Identity = 35/43 (81.40%), Postives = 38/43 (88.37%), Query Frame = -1 Query: 594 CQHCGISEKLTPAMRRGPAGPRTLCNACGLMWANKGTLRDLTK 722 C HCGIS K TP MRRGP+GPRTLCNACGL WAN+GTLRDL+K Sbjct: 214 CTHCGISSKCTPMMRRGPSGPRTLCNACGLFWANRGTLRDLSK 256 The following BLAST results are available for this feature:
BLAST of CX069428 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX069428 ID=CX069428; Name=CX069428; organism=Citrus sinensis; type=EST; length=758bpback to top |