DR403425

Overview
NameDR403425
Unique NameDR403425
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length786
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6092 contig Csv1_Contig6092:1..786. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DR403425 vs. ExPASy Swiss-Prot
Match: RECAC_ARATH (DNA repair protein recA homolog 1, chloroplastic OS=Arabidopsis thaliana GN=RECA PE=2 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 2.364e-68
Identity = 119/169 (70.41%), Postives = 131/169 (77.51%), Query Frame = 2
Query:  152 FSPFNMKTHLCLLSISSSPLHCQSSRSRFFTASSKLSAARKRDKKISCEFDGKVNGFSSDSGDSRFLDRQRALDAAMNDINSSFGKESVTRLGSAGGALVETFPSGCLTLDLALGGGLPKGRIVEIFGPESSGKTTLALHAIAEVQKLGGNAMLVDAEHAFDPSYSKAL 658
            F+P +        S  S  L   S  SR   +   + AA+K   KIS EFD ++NG  S   DSRFLDRQ+AL+AAMNDINSSFGK SVTRLGSAGGALVETF SG LTLDLALGGGLPKGR+VEI+GPESSGKTTLALHAIAEVQKLGGNAMLVDAEHAFDP+YSKAL
Sbjct:   15 FTPLSPLFPFTPCSSFSPSLRFSSCYSRRLYSPVTVYAAKKLSHKISSEFDDRINGALSPDADSRFLDRQKALEAAMNDINSSFGKGSVTRLGSAGGALVETFSSGILTLDLALGGGLPKGRVVEIYGPESSGKTTLALHAIAEVQKLGGNAMLVDAEHAFDPAYSKAL 183          

HSP 2 Score: 60.077 bits (144), Expect = 2.364e-68
Identity = 31/45 (68.89%), Postives = 34/45 (75.56%), Query Frame = 3
Query:  651 KHXGVDVENLIVRXXDNGEMALEIADRMCRSGAIDLYLC*LCISS 785
            K  GVDVENLIV   DNGEMALE ADRMCRSGA+DL    +C+ S
Sbjct:  181 KALGVDVENLIVCQPDNGEMALETADRMCRSGAVDL----ICVDS 221          

HSP 3 Score: 21.1718 bits (43), Expect = 2.364e-68
Identity = 9/9 (100.00%), Postives = 9/9 (100.00%), Query Frame = 1
Query:  760 ICVDSVSAL 786
            ICVDSVSAL
Sbjct:  217 ICVDSVSAL 225          
BLAST of DR403425 vs. ExPASy Swiss-Prot
Match: RECA_CYAP7 (Protein recA OS=Cyanothece sp. (strain PCC 7424) GN=recA PE=3 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 2.265e-40
Identity = 71/102 (69.61%), Postives = 82/102 (80.39%), Query Frame = 2
Query:  353 DRQRALDAAMNDINSSFGKESVTRLGSAGGALVETFPSGCLTLDLALGGGLPKGRIVEIFGPESSGKTTLALHAIAEVQKLGGNAMLVDAEHAFDPSYSKAL 658
            D+++AL+  +N I  SFGK S+ RLG A    VET PSG LTLDLALGGGLPKGR++EI+GPESSGKTTLALHAIAEVQK GG A  VDAEHA DP+YS+ L
Sbjct:    9 DKEKALNLVLNQIERSFGKGSIMRLGDAARMRVETIPSGALTLDLALGGGLPKGRVIEIYGPESSGKTTLALHAIAEVQKAGGVAAFVDAEHALDPTYSEVL 110          

HSP 2 Score: 41.9726 bits (97), Expect = 2.265e-40
Identity = 18/33 (54.55%), Postives = 24/33 (72.73%), Query Frame = 3
Query:  660 GVDVENLIVRXXDNGEMALEIADRMCRSGAIDL 758
            GVD+ NL+V   D GE ALEI D++ RS A+D+
Sbjct:  111 GVDIHNLLVAQPDTGESALEIVDQLVRSAAVDI 143          
BLAST of DR403425 vs. ExPASy Swiss-Prot
Match: RECA_SYNS3 (Protein recA OS=Synechococcus sp. (strain CC9311) GN=recA PE=3 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 6.520e-40
Identity = 71/116 (61.21%), Postives = 83/116 (71.55%), Query Frame = 2
Query:  311 VNGFSSDSGDSRFLDRQRALDAAMNDINSSFGKESVTRLGSAGGALVETFPSGCLTLDLALGGGLPKGRIVEIFGPESSGKTTLALHAIAEVQKLGGNAMLVDAEHAFDPSYSKAL 658
            V    S +GDSR  +R +ALD  +  I  +FGK S+ RLG A    VET  +G LTLDLALGGG PKGR+VE++GPESSGKTTL LHAIAEVQK GG A  VDAEHA DP Y+ +L
Sbjct:    5 VKAAQSSAGDSRPGERDKALDLVLGQIERNFGKGSIMRLGDASRMRVETISTGALTLDLALGGGYPKGRVVEVYGPESSGKTTLTLHAIAEVQKRGGVAAFVDAEHALDPVYAASL 120          

HSP 2 Score: 46.2098 bits (108), Expect = 6.520e-40
Identity = 20/33 (60.61%), Postives = 26/33 (78.79%), Query Frame = 3
Query:  660 GVDVENLIVRXXDNGEMALEIADRMCRSGAIDL 758
            GVD+ENL+V   D GEMALEI D++ RS A+D+
Sbjct:  121 GVDIENLLVSQPDTGEMALEIVDQLVRSAAVDI 153          
BLAST of DR403425 vs. ExPASy Swiss-Prot
Match: RECA_SPIPL (Protein recA OS=Spirulina platensis GN=recA PE=3 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 8.500e-40
Identity = 67/102 (65.69%), Postives = 82/102 (80.39%), Query Frame = 2
Query:  353 DRQRALDAAMNDINSSFGKESVTRLGSAGGALVETFPSGCLTLDLALGGGLPKGRIVEIFGPESSGKTTLALHAIAEVQKLGGNAMLVDAEHAFDPSYSKAL 658
            ++Q+AL++ +N I  SFGK S+ RLG +    VET  SG LTLDLALGGGLP+GR++EI+GPESSGKTTLALHAIAE+QK GG A  VDAEHA DP+Y+ AL
Sbjct:    9 EKQKALNSVLNQIEKSFGKGSIVRLGDSARMKVETISSGALTLDLALGGGLPRGRVIEIYGPESSGKTTLALHAIAEIQKTGGIAAFVDAEHALDPTYAAAL 110          

HSP 2 Score: 45.0542 bits (105), Expect = 8.500e-40
Identity = 20/33 (60.61%), Postives = 26/33 (78.79%), Query Frame = 3
Query:  660 GVDVENLIVRXXDNGEMALEIADRMCRSGAIDL 758
            GVD+ENL+V   D GEMALEI D++ RS A+D+
Sbjct:  111 GVDIENLLVSQPDTGEMALEIVDQLVRSVAVDI 143          
BLAST of DR403425 vs. ExPASy Swiss-Prot
Match: RECA_SYNP2 (Protein recA OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=recA PE=3 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 3.193e-39
Identity = 65/102 (63.73%), Postives = 79/102 (77.45%), Query Frame = 2
Query:  353 DRQRALDAAMNDINSSFGKESVTRLGSAGGALVETFPSGCLTLDLALGGGLPKGRIVEIFGPESSGKTTLALHAIAEVQKLGGNAMLVDAEHAFDPSYSKAL 658
            D+++AL+  +N I  +FGK ++ RLG A    V T PSG LTLD A+GGG P+GRIVEI+GPESSGKTT+ALHAIAEVQK GG A  +DAEHA DP+YS AL
Sbjct:    9 DKEKALNLVLNQIERNFGKGAIMRLGDAAQMKVATIPSGALTLDQAMGGGFPRGRIVEIYGPESSGKTTVALHAIAEVQKAGGVAAFIDAEHALDPTYSAAL 110          

HSP 2 Score: 48.521 bits (114), Expect = 3.193e-39
Identity = 22/33 (66.67%), Postives = 27/33 (81.82%), Query Frame = 3
Query:  660 GVDVENLIVRXXDNGEMALEIADRMCRSGAIDL 758
            GVD+ENL+V   DNGE ALEIAD++ RS A+DL
Sbjct:  111 GVDIENLLVAQPDNGESALEIADQLVRSAAVDL 143          
BLAST of DR403425 vs. ExPASy Swiss-Prot
Match: RECA_TRIEI (Protein recA OS=Trichodesmium erythraeum (strain IMS101) GN=recA PE=3 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 5.417e-39
Identity = 68/102 (66.67%), Postives = 80/102 (78.43%), Query Frame = 2
Query:  353 DRQRALDAAMNDINSSFGKESVTRLGSAGGALVETFPSGCLTLDLALGGGLPKGRIVEIFGPESSGKTTLALHAIAEVQKLGGNAMLVDAEHAFDPSYSKAL 658
            ++Q+ALD+ +  I  +FGK S+ RLG A    VET  SG LTLDLALGGGLPKGR++EI+GPESSGKTTLALHAIAE QK GG A  VDAEHA DP+Y+ AL
Sbjct:    9 EKQKALDSVLKTIEKTFGKGSIVRLGDATRMKVETISSGALTLDLALGGGLPKGRVIEIYGPESSGKTTLALHAIAETQKSGGIAAFVDAEHALDPTYAAAL 110          

HSP 2 Score: 44.2838 bits (103), Expect = 5.417e-39
Identity = 19/33 (57.58%), Postives = 25/33 (75.76%), Query Frame = 3
Query:  660 GVDVENLIVRXXDNGEMALEIADRMCRSGAIDL 758
            GVD+ENL+V   D GEMALE+ D + RS A+D+
Sbjct:  111 GVDIENLLVSQPDTGEMALEVVDHLVRSVAVDI 143          
BLAST of DR403425 vs. ExPASy Swiss-Prot
Match: RECA_SYNY3 (Protein recA OS=Synechocystis sp. (strain PCC 6803) GN=recA PE=3 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 5.418e-39
Identity = 70/102 (68.63%), Postives = 80/102 (78.43%), Query Frame = 2
Query:  353 DRQRALDAAMNDINSSFGKESVTRLGSAGGALVETFPSGCLTLDLALGGGLPKGRIVEIFGPESSGKTTLALHAIAEVQKLGGNAMLVDAEHAFDPSYSKAL 658
            DR++AL+AA+  I  SFGK ++ RLG A    VET  +G LTLDLALGGGLPKGRIVEI+GPESSGKTTLALHA+A  Q+ GG A  VDAEHA DP YSKAL
Sbjct:    8 DREKALNAALAQIERSFGKGAIMRLGDATQMRVETISTGALTLDLALGGGLPKGRIVEIYGPESSGKTTLALHAVAATQQAGGVAAFVDAEHALDPVYSKAL 109          

HSP 2 Score: 45.0542 bits (105), Expect = 5.418e-39
Identity = 20/36 (55.56%), Postives = 27/36 (75.00%), Query Frame = 3
Query:  651 KHXGVDVENLIVRXXDNGEMALEIADRMCRSGAIDL 758
            K  GVD++NL+V   DNGE ALEI D++ RS A+D+
Sbjct:  107 KALGVDIDNLLVAQPDNGESALEIVDQLVRSTAVDI 142          
BLAST of DR403425 vs. ExPASy Swiss-Prot
Match: RECA_CYAP8 (Protein recA OS=Cyanothece sp. (strain PCC 8801) GN=recA PE=3 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 5.420e-39
Identity = 70/102 (68.63%), Postives = 80/102 (78.43%), Query Frame = 2
Query:  353 DRQRALDAAMNDINSSFGKESVTRLGSAGGALVETFPSGCLTLDLALGGGLPKGRIVEIFGPESSGKTTLALHAIAEVQKLGGNAMLVDAEHAFDPSYSKAL 658
            D+++AL   +N I  +FGK S+ RLG A    VET  SG LTLDLALGGGLP+GRI+EI+GPESSGKTTLALHAIAEVQK GG A  VDAEHA DP+YS AL
Sbjct:    9 DKEKALGLVLNQIERNFGKGSIMRLGDAARMRVETISSGSLTLDLALGGGLPQGRIIEIYGPESSGKTTLALHAIAEVQKAGGVAAFVDAEHALDPNYSNAL 110          

HSP 2 Score: 42.743 bits (99), Expect = 5.420e-39
Identity = 18/33 (54.55%), Postives = 25/33 (75.76%), Query Frame = 3
Query:  660 GVDVENLIVRXXDNGEMALEIADRMCRSGAIDL 758
            GVD++NL+V   D GE ALEI D++ RS A+D+
Sbjct:  111 GVDIDNLLVAQPDTGESALEIVDQLVRSAAVDI 143          
BLAST of DR403425 vs. ExPASy Swiss-Prot
Match: RECA_PROMM (Protein recA OS=Prochlorococcus marinus (strain MIT 9313) GN=recA PE=3 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 2.647e-38
Identity = 65/102 (63.73%), Postives = 78/102 (76.47%), Query Frame = 2
Query:  353 DRQRALDAAMNDINSSFGKESVTRLGSAGGALVETFPSGCLTLDLALGGGLPKGRIVEIFGPESSGKTTLALHAIAEVQKLGGNAMLVDAEHAFDPSYSKAL 658
            +R +AL+  +  I  +FGK S+ RLG A    VETFP+G LTLDLALGGG PKGR+VE++GPESSGKTTL LHAIAEVQ+ GG A  VDAEHA DP Y+ +L
Sbjct:   24 ERDKALNLVLGQIERNFGKGSIMRLGDASRMRVETFPTGALTLDLALGGGYPKGRVVEVYGPESSGKTTLTLHAIAEVQRRGGVAAFVDAEHALDPVYAASL 125          

HSP 2 Score: 46.2098 bits (108), Expect = 2.647e-38
Identity = 20/33 (60.61%), Postives = 26/33 (78.79%), Query Frame = 3
Query:  660 GVDVENLIVRXXDNGEMALEIADRMCRSGAIDL 758
            GVD+ENL+V   D GEMALEI D++ RS A+D+
Sbjct:  126 GVDIENLLVSQPDTGEMALEIVDQLVRSAAVDI 158          
BLAST of DR403425 vs. ExPASy Swiss-Prot
Match: RECA_PROM3 (Protein recA OS=Prochlorococcus marinus (strain MIT 9303) GN=recA PE=3 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 2.647e-38
Identity = 65/102 (63.73%), Postives = 78/102 (76.47%), Query Frame = 2
Query:  353 DRQRALDAAMNDINSSFGKESVTRLGSAGGALVETFPSGCLTLDLALGGGLPKGRIVEIFGPESSGKTTLALHAIAEVQKLGGNAMLVDAEHAFDPSYSKAL 658
            +R +AL+  +  I  +FGK S+ RLG A    VETFP+G LTLDLALGGG PKGR+VE++GPESSGKTTL LHAIAEVQ+ GG A  VDAEHA DP Y+ +L
Sbjct:   24 ERDKALNLVLGQIERNFGKGSIMRLGDASRMRVETFPTGALTLDLALGGGYPKGRVVEVYGPESSGKTTLTLHAIAEVQRRGGVAAFVDAEHALDPVYAASL 125          

HSP 2 Score: 46.2098 bits (108), Expect = 2.647e-38
Identity = 20/33 (60.61%), Postives = 26/33 (78.79%), Query Frame = 3
Query:  660 GVDVENLIVRXXDNGEMALEIADRMCRSGAIDL 758
            GVD+ENL+V   D GEMALEI D++ RS A+D+
Sbjct:  126 GVDIENLLVSQPDTGEMALEIVDQLVRSAAVDI 158          
The following BLAST results are available for this feature:
BLAST of DR403425 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RECAC_ARATH2.364e-6870.41DNA repair protein recA homolog 1, chloroplastic O... [more]
RECA_CYAP72.265e-4069.61Protein recA OS=Cyanothece sp. (strain PCC 7424) G... [more]
RECA_SYNS36.520e-4061.21Protein recA OS=Synechococcus sp. (strain CC9311) ... [more]
RECA_SPIPL8.500e-4065.69Protein recA OS=Spirulina platensis GN=recA PE=3 S... [more]
RECA_SYNP23.193e-3963.73Protein recA OS=Synechococcus sp. (strain ATCC 272... [more]
RECA_TRIEI5.417e-3966.67Protein recA OS=Trichodesmium erythraeum (strain I... [more]
RECA_SYNY35.418e-3968.63Protein recA OS=Synechocystis sp. (strain PCC 6803... [more]
RECA_CYAP85.420e-3968.63Protein recA OS=Cyanothece sp. (strain PCC 8801) G... [more]
RECA_PROMM2.647e-3863.73Protein recA OS=Prochlorococcus marinus (strain MI... [more]
RECA_PROM32.647e-3863.73Protein recA OS=Prochlorococcus marinus (strain MI... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCSAF-PNP1244P19 Flavedo Mature Citrus sinensis cDNA clone CSAF-PNP1244P19 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR403425 ID=DR403425|Name=DR403425|organism=Citrus sinensis|type=EST|length=786bp
GGGGGACCCACTTTGCTTCTGCTTCTGCTCTCTGCTTCTGTGACTTGTGT
CTCCTCGTGTTTCGTCTATTATTTTCTTACAAATAATGGAGTCTCTCGCA
GCAGCAGCTGTGCCTCTGAAAGCAAAACTGGGTGTGTGCCATCAGCTATG
TTTCTCCCCATTCAACATGAAGACACACTTATGTCTCTTGTCAATTTCTT
CAAGTCCCCTTCATTGCCAATCTTCCCGCTCTCGGTTCTTCACAGCCTCG
TCCAAGCTGTCAGCTGCCAGAAAACGTGACAAGAAAATCAGCTGCGAATT
TGACGGAAAAGTTAATGGCTTTTCTTCCGACTCCGGAGACTCCCGCTTCC
TCGACCGGCAAAGAGCGTTGGATGCAGCAATGAATGACATAAACAGTTCA
TTTGGAAAAGAGAGTGTTACAAGATTGGGCAGTGCTGGTGGAGCCCTTGT
TGAAACCTTTCCCAGTGGTTGCTTGACGCTGGATTTGGCCTTAGGTGGTG
GGCTTCCTAAAGGGAGAATTGTGGAGATATTTGGGCCAGAAAGTAGTGGA
AAGACTACCCTTGCACTCCATGCAATTGCAGAAGTGCAGAAACTCGGAGG
CAATGCAATGCTTGTGGATGCAGAGCATGCTTTTGATCCATCATATTCAA
AAGCATTGNGGCGTGGATGTAGAGAATTTGATTGTTCGCCANNNTGATAA
CGGCGAGATGGCACTAGAAATTGCCGATCGTATGTGCAGATCTGGTGCCA
TAGATCTTTATTTGTGTTGACTCTGTATCAGCTCTC
back to top